GenomeNet

>tr:A0A261BEQ7_9PELO [A0A261BEQ7] RecName: Full=RING-type domain-containing protein {ECO:0000259|PROSITE:PS50089}; Flags: Fragment;
MSMLSSVLCLKCEGMYNENRKTCIGSCGHSICEKCFDEKQSGSCSICKTEHAFDEKRFNW
HAPDMVKTLLESISLTSVCNMNTDHTTVGHGLCSECKGHSNKLRICADCAIQHNLLEKSD
NGGLKLSKDSSEEELLEAKILRIRSTALCADCVMDGRKHDGHQMVPLGDVQYMNDATEVL
DSHAALIFLFHNIWKECDEHKYMKLDLQLYNFHCECFLIIEKLIEHLENDSSADSELFKP
TEYMDQVYGSVWHFRIRVEDSLKEASNYMEIESSTEEKLEWKKTIEQLECIRGFYDFIIL
KGHFEGSSPIPMDGVLKHGSSLKLGQPSFGSDNSVEAMRLIFKTLPMFGSRFEQSERDKE
QQLEKPKLDEI

BLAST