GenomeNet

>tr:A0A268E3M2_9BACI [A0A268E3M2] SubName: Full=Phosphatase PAP2 family protein {ECO:0000313|EMBL:PAD67689.1};
MKTKLFTNMYDFECRLFRSVNRHYDRKFLNFYFRHITHLGGAIATITASLFLIFFTKGLI
QLTGIASAISLLISHLPVALVKKLYPRKRPYITLMETKVPANPLKDHSFPSGHTTAIFSV
IIPFILFIPELSFILLPIAISVGISRMYLGLHYPSDVLAGCLLGCSSGVLSYFMLNQLIF
TAAI

BLAST