GenomeNet

>tr:A0A286BXG8_9ENTR [A0A286BXG8] SubName: Full=Polysaccharide export outer membrane protein {ECO:0000313|EMBL:SOD38842.1};
MKTKLIPLLVSATFLSGCTIEPGSHLSTSGKDVIEQQDSNYDIDKYVNVFPLTPRLVEQM
RPKPLVAQANPLLQNEIQSYEYRIGVGDVLNVTVWDHPELTTPAGQYRSASDTGNWVQAD
GSIFYPYIGKVRVAGRTVTEIRTEMARRLAQFIESPQVDVNVASFRSQKAYITGSVTTSG
QQPITNVPLTVLDAVNAAGGLAADADWRNVVLTHNGKEQRISLQALMQNGDLSQNHLLYP
GDILYVPRNDDLKVFVMGEVKQQSTLKMDRSGMTLAEALGNSQGMDQTTSDATGVFVIRP
IRGANRTKIANIYQLNTKDAASMVMGTEFQLEPYDIVYVTATPITRWNRVISGLLPTIVG
VDDASSAALRFRTWGN

BLAST