GenomeNet

>sp:A0A287LCX4_HORVV [A0A287LCX4] RecName: Full=acidPPc domain-containing protein {ECO:0000259|SMART:SM00014};
MQIYGIIGPIIIITSIYIKRRNVYDLHHAILGLLFSVAITAVLTDAIKNGVGRPRPDFFW
RCFPDGVPAYDNVTTGVLCHGKASDIKEGHKSFPSGHTSLSFAGLGFLSWYLAGKIKVFD
RRGHVAKLCIIFLPLLGAALVAISRVDDYRHHWQDVCTGGVLGLVVASLCYLQFFPLPSD
ENGLWPHAYTRHIHNPEGANTSATHSDASPKLGAERFV

BLAST