GenomeNet

>tr:A0A287U0U3_HORVV [A0A287U0U3] RecName: Full=RING-type domain-containing protein {ECO:0000259|PROSITE:PS50089};
MKCNACWRELEGQAITTTCGHLLCTEDAKKILSNDGACPICDQVLSKSSHMKPTDINPSD
EWTNMSMTGVSPQILMKSAYRSVMFYIGQKDLEMQYKMNRIVGQCRQKCEVMQAKFTEKL
EEVHAAYQKMAKRCQLMEQEIENLTRDKQELQEKFAEKSRQKRKLDEMYDQLRNEYESVK
RSAIQPANNYFPRAQPHLFSGMPNILDSGDPLRQGSIDPPETPGRRDEGWAPQPRQRREN
SGPFELSGGSPGHTAAPPMDMRPRQLPRSVFGANMNNSSTALRNMIISPVKRPQPRNRPQ
MFT

BLAST