GenomeNet

>tr:A0A287VM35_HORVV [A0A287VM35] SubName: Full=Uncharacterized protein {ECO:0000313|EnsemblPlants:HORVU7Hr1G020590.15};
PAAPHHPLAHPHISPAPPPSLIGARRRRPSRRLSKVVSYYGLTTPPYKTDALEPYMSRRA
VELHWGKHQQEHVDGLNKQLAISPLYGHTLEDLIKDAYNNGNPLPEHNAAAEVWNHHFFW
ESMQPEGGGSPEAGVLQQIEKDFGSFVNFREEFMRSALSLLGSGWVWLVLKRSERKLAVV
HTLNAINPLAFGDMPIISLDLWEVRKLDLCFDPIVCQLRGTDIPLFPFQHAYYLDYKDDR
RTYVSNFLDHLVSWHTVTLRMMRAEAFVNLGEPNIPVA

BLAST