GenomeNet

>tr:A0A2A2GVA1_9GAMM [A0A2A2GVA1] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:PAV01048.1};
MDQPIELTGDVACYKAFDEKGKEFDGRLVQAELLGILKDSPKAGEATFVSDDESVYNAKF
VKWSSQC

BLAST