GenomeNet

>tr:A0A2A2HQF3_9GAMM [A0A2A2HQF3] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:PAV11570.1};
MKGKILLTALAFSSVSMIASAVETDNLVVYSTQQDKGATSLGNQAFYTKSFDVTLANVGD
KDADLSKFCLKAYNKHGKTFKLDTIEETLTTGNLLPKKTVKGMAVFASNDESVYDASIVK
LSYECDINDKK

BLAST