GenomeNet

>tr:A0A2A9P5Y1_9HYPO [A0A2A9P5Y1] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:PFH56282.1};
MDRTTSDLAWVLSGEDSFNIYMFHGGTNWGFDNGAVWSGDRSLAVTTSYDYGAPLDESGR
PTELYHQIRETIAKHVPAGSIPHVPAVPRLIQTGDIVLKPVLSLFDMLPKQPMIESAAPV
PMEHMDQSYGFVLYQHTVEEEAEGILFVGDGPRDRVLVYQNGHRVGIIDGTYSSPGRVRV
RLNEGDLLQLLVENLGRVDKGHKFEDQRKGIVGNVTVGTRQTLERWKTYSLPLTKLPRGL
SRGDKVVVFHRQSPMFYTGSFRLAENAQPGLGSDMFLSIDKAIKGQVWVNGVNLGRYWAM
GPQQSLYLPGCYLNAAGRSNKIVVLELEPEANRPMVAKGLSSREWFNRPDPDSVV

BLAST