GenomeNet

>tr:A0A2B2CE05_9BACI [A0A2B2CE05] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:PFP30425.1};
MKNSQPSTLSKKKYTYNILESIETEIEVTKNPYELSIQELFTMAARINKKRSFLFVSKVL
GKHIPINPHKGLLTAALLGARYLEMVQGIKYVETEKLLTSFYREEIYKSRAFIPTHVSPV
VIGFAETATALGHAFFDCFQNAEYFHTTREEINQMRPEITFEEEHSHATSHRCYIPLEMI
QNEREIILVDDELTTGKTALNIIKSIHNKFPRRVYTIVSILDWRSEQDRKRFQQFQQELG
IKINVVSLITGKVQVKQMREIANHSPITERKKYAKATVEWVDISSFFSKTTLSVDNPMNQ
SAFIYETGRFGLSSSENNNLHHIASLAAAKLNQKRSGNKTLCLGTGEFMYLPMKLASLMG
NGVFYQSTTRSPIFIENKVGYGARFGVSFPNPEALSITHFVYNIPPGFYDELFVFMERKV
ELESLQPLLKELEKLQIKMIRLVYFSNNRGEQNEKHNQ

BLAST