GenomeNet

>sp:A0A2B4SK07_STYPI [A0A2B4SK07] SubName: Full=Gamma-aminobutyric acid receptor subunit beta-4 {ECO:0000313|EMBL:PFX28867.1};
MMFKFYIRAFGVLLRSFMVLANICPVNATKTDDSKRAVEVDIADGSLPPLTEPPNATAIL
DKMFVNYDKRLRPMYGGDPVYIYVSLGFLSISHVTEENMEFKGDIYMRQFWKDPRLAYGD
KNWTLILQGDILRKMWFPDTYIENGKKTTIHDDTRTVIVFGDGNVFYSVRVTVNAMGLMD
FKNYPMDVQLFFFRVLSYGFDITQIRYKWIGASLYSTDMAEFYVMNQTLASDKVKYMIGW
FDYLDVNFHVRRRIGHYVIRIFFPCILCTVVSWLPFWMDRNEIGDRGALGITTLLTEVFL
LQYTNDSMPRVSYVKAADLFLIVSFAFTFMALLESVIVYNYKKKSFMAESTQTKSLTGGR
TFFRKRTAKVEEVCKAGTVHINGSYINPTVPAEPEDPPRPLPEPQGKKAPWKEPEDEKQE
LPRCSALSKSKIRSYYTSVKSYLAKTDLSFFIEMSSRILFPLMYIGFIAFFFGKYGI

BLAST