GenomeNet

>tr:A0A2C9C384_CAEEL [A0A2C9C384] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:SOF58814.1};
MDFDFTDISDEDHNYVTKGDIVCLSCVASHNRDGVLGSERVCLCTEGFGNRMCTLENVSD
KDIPPDIAMCMLYIDNALSMRALQEMMSADSDHKSASGAGGHKTLLYGHAVQLKHVQSEM
YLACLSSCSSNDKLAFDVGVQETNEGEACWWTIHPASKQRSEGEKVRVGDDVILVSVATE
RYLHMAYSKGYMVIASFHQTLWNIQSVSSGSMRTRNMGFLFGNDVLRLFHGNDECLTIPE
NWSEHPQHNMVIYEGGAAVTQARSLWRVELIRMKWHGALVGWEQVFRIKHITSGRYLGVL
DNSVQLYHKEKADFDLTAFVMCQNKDPKKQMLDEKEEEGMGNATIRYGETNAFIQHVKTQ
LWLSYQTTEVTKKGLGKVEEKKAVALKDGHMDDCYTFFMALEEESKSARVIRKCSSVLNK
FLKGIDALQLEGNQSTDWTRVDLNEVLKLMEDLIEYFAQPNDEQDFEEKQNHLRALRSRQ
DLFQEEGVLNMILDTIDKFSQMEALPDFAGLIGEETHVKWEQISTYLYLLVAAMIKGNHY
NCAQFASAQRLDWLFGRLSNPQSAEGILDVLYCVLTESPEALNMINEGHIRSVISLLEKV
GRDPKVLDVLSSLCEGNGMAVRSSQNLITQYLLPGKDLLLQTSMRDHVSSMMPNVMLGVV
EGSALFRKWYFEAEVEHIETMTKQTPYLRIGWANSVGFKPFPGSGDKMGCNGVGDDFYSY
GFDGKSMYFGGKSRRVGHKLLEKGDVIGCSIDLTIPEIKFSVNGTYMSGSFKKFNIDGYF
FPVMSLSAKVSCRFILGGNQGRLRYGPPTGFSAVVEAVNGELQITDCLSFGDLGKNIFSG
PQTIFNNLEPFIPTPIDVSATQLNHHATEMHQKYAENLHELWAMRKIELGWSYGETRSET
SRKHPCLTKFEYLPETEKKYNILLALTTMKTIEALGYHLITEDPPCRLRAVRLGPNFQQQ
NGYKPGPLDTHEIQLPAELQPLTEALARNTHNIWAKEKIKRGWTFGLSEHVDATQKRSPH
LVPYEQVDERIKQANRESAAENIRALQLFGIFLEPPAHEHDEVAEKELRARKDNTRTYRA
EATYAVCGGKWYFEFEILTAGYMKIGWMDIGSTPEIQLGADDRSYAFDGYLGRKWHQGAE
TYGKEWKIGDVVGCFLDLNDRTISFSLNGELLLDPSGSEMAFDNVVCGDGLVPAMTLGSG
QRGRLNFGQQSNSLKFFTTCGLQEGYEPFCVNMYRTMPMWFAKQLPRFEDISTLKSGSIL
EVSRIPATGNSPPCLKILQKVTISEGGPSEKAKMEYIKLSLPVKCNDTFVKNKDKETIRR
QLQEYKPRSQSVVSQIRAPGIPKEFDDNKEKKGFLRSMLGSKDSHESDDDRRSRTNSKQP
SVDGDEPPAVRRSLLELPHDERQIAEDSMRDLNDRHSEKPKKGGLLSRLRDSSNTRKNFR
DSDRRKEEKAAQLRQMKANSRSFDAGSLDTSTLPTGQKDVLASSEMPLSGPGRQLTIKRS
SIKKNKKGKKAEIALEKMEREKKGSIIPMDAQLDVLQEGDAHALVHHKDKVDEYYYGIRI
FPGQDPSQVWVGWVTTQYHYYNVNFDGSQGVRKCRFSEADHHGTTVDSVQSQNCYMVNVS
ELLATTPDVANTKVSGTLIGCIIDTSIGELSFQVGSTDTGIKFKLEPGAMLFPAAFVTPT
ATEILQFELGRIKYTFPLSAAMFKSCEKSLVPFCPPRLTVEQIESVYWARVPNETLRTTA
LKLSEVRGWSVLCNDPVRIMSVYIPEKDQSLDILEMIEMPDMLEFHRQTLNLYCKLASHG
NHKVAHTLCQHIDEDQIMYAIKSHYLSGPMRQGFHDLLIGLHLMSHTAARNSMAKEYVIP
LVPQLQIKNVLDPDSESRYPQITGESVSMLSQMASEPVKKHVSREDEMKLLPPSVDFEAL
KKHVMESLQSATHHAVMNCRDLIGGDNTNHFEPLFKLFDQLLVIGLINDEELECLLRLIH
PQAFDENYETGTTQKGLTQLELAEPVKIQLVSILDHLCDIQLRYRIESLVAFTEGFVGEL
QSDQCKRYMEIKQTDMPPAEAAKKTKEFRCPPKEQMFRLLMCKVKEERDPELMEEDADVD
QCPMAEGLQQQLRDFCELLVGKIGNVKEGDSDDQLALIESEEGSWVDSFARIVVKVPPPV
LEEGMEMQKKGTQNFREIIVTMLREWAQADFIESKSLIRNMFRLLLRQYSGIREIRDAMS
QTYVFHERNEKDVTDFLVYLIQIRELLTVQFEHTEEAILKRGLWKLMNNRIFFQHPDLMR
LLSVHENVMSIMMNILTAQQGTVEHEGDELKEKAPIKDASEMVVACSRFLCYFCRTSRQN
QKAMFEHLSFLLDNATMLLARPSLRGSVPLDVAYSSFMDNNELALALKEEELDKVAVYLS
RCGLQPNSELITKGYPDIGWDPVEGERYIDFLRFCVWINGENVEENANLVIRLLIRRPEC
LGVALKGEGQGLFSAFKEAIALSEDIRLLENDSHPSLLSSGLLGENPTYPSKDAEGEDYI
DLGAATLDFYSSLVDLLAKCAPDPMAIQAGKGDSLRARAILRSLISLDDLGQILALRFTI
PNLAAPSIEAVRRANAVQASHTQKAVMAHTFAMVASLASEVSNTRRSQTFTSGTNLAKRG
LPCVEEVDTDDSKSSDYASVHTSFSSGNELFAPKAEKEKVDVLKLNENKYPIIQRRRSSR
FNPIDNTGPLPGLLPNHKGSVLLFLDRVYGIDQQDMLFHVLEQSFLPDLRAATMMDSPRA
LESDTALALNRYLCNSVLPLLTNHSHFFADAEHHSALLDATLHTVYRMNRLKSLTKNQRD
AVSDFLVAITRELPPAMMIKLLKKVITDILTMNDMNVLVPLRLITLHYERCGKYYGSGNH
YGVASEQEKRLSMLLFDAIFDTLGSRPYDPELFGKALPCMTAIGSAISPDYTLTSGLEDV
RNKRREEEGAWIPRTVDVSRCEINRDLEKMTELFAEHFHDSWASRKLEKGWVHGDLYSRA
NFTHPRLKPFALLKDFEKSFYKERCSECLKALMAWNYSFEMMDRDANDRASAARTLSGTS
ISNFAPKPIDLSSMTLEKDMVNAAEKMAEHSHLIWAKKVMNDLNTKGGFMPIPLVPWDLL
TDFERRKDRFRASEILKFLQYHGYHVNCPKDEQSQNDRLKSEGERTSVEKRFAYNLLEKL
ITYLEQASLKMKSVKPSQELTRRNSFKKEGQDVKFFEKVVLPLMHAYFNAHKNYFLEGSS
IVQTGTASNKEKEMVANLFCRLAALLRIKNRAFGSVAKITVKCLQGLTQALDLRTLVKVN
SDIVRTSLLTFFNNCADDLYASVNELKDGGQYSLIRGQALKSWNSFEFANQMIVPVLTTM
FAHLARNHFGTDLLLDDIQAACYKILDSLYMVTGLSSSISHRKSISGESEKHRPGLGQCL
AAFASCFPVAFLEPEFNKSNKFSVLAKSQDQSVQVQEMLQNLSTHIPHLEKLLTDLETVA
NNNTMYSDVPNVYDVDLPLMCSYMAHWFSVGPDGKRDKEDQRASVVQTTSVSCDHINRIF
NALLKMIRNHVGIENAPWLCRVNFFAVQIIQNVTSDPVREFVLPIAERLRRMSEKAYKEE
EHMRTHPDDADEGTVAEDNARLVRDTYAFFPILMKYTDLHRAQWLKTPTWETDGVYENVA
VIFRIWSQSQHFKREELNYVAQFEEDAAATGGGDMKTGKAAIAERKKKRREGQDKMKEYF
DRNGRPIIKKDKHAASIVIACLKRLLPVGLNVFGGRELDIVQQSKEKFIQKETEEKIREF
IKGLLEIPVKTDPTDKNAWQLSLYRKIGKSQMRGKDEMSQDAVIEKIFNMGQVSAILHTT
EHPQMQLSQAWKKVVSTQRKRAVVACFRMVPLYGIPRHRGINFFLPAFSRLWMEEEDAGQ
DQLIADICSGVEEEEGPRIEIIMEEGVPIVASSEDTKEKETNPDPLKQLIRCFQRAATSE
ETAASAIHEDSLYIRFADVMAKSIHIEEEDGEDGEEGEIDQAAKEEQSQALRGEQAVLAS
RGAAIMCLMYLSASGGEPNEMVAQTLQLGIHLLSGGNVEIQKMLIEYLQLKKDVRFFTSM
AGLMNKCSVLNLEMFERQIKAEGLGMGAELASGDNQNLNDADFTCSLFRFLQLTCEGHNL
EFQNYLRTQPGHTTSVNLINCTVDYLLRLQESVMDFYWHYSSKEVIDEGGKEYFLRAIQV
CSQVFNTLTESIQGPCVGNQMTLANSRLWDAINGFFFLFAHMMEKLYKNSTQLELLREFL
NLQKDMIVLMLSMLEGNVLNGSIGKQMVDALVESQPSVEKILKFSDMFLKLKDLTTSQAF
QDFDTNQDGWISPKEFQRAMESQKMYTVEDITYLMMCTDVNNDGKVDYMEFTERFHNPAR
DIGFNLAVLLVNLKEHITNDPRLEKIIEKAQTLLEYFDPFLGRIEIMGSSKRVEKIYFEI
QESWLEQWGKQQIRDSKNSFLFNVLQDDGGDQGKLEAFINFCEDTIFEMQHAAAISSGDS
DTKMERAIKQRDYFLQQTSADHISETFKSGYNYGISAASALSPQNISTTMRNVSSSVRQM
SWTQLLYAVIILFIRAGLAIGWAGYLLLMTIFRFGYFLTTSSEEEEAARQEKEQAKMNNE
HPSFNPPIIQEFHHSHVGVTAFGVGMNADHLNVNSLPDFVPPERPETPETVLEEEKPLNQ
ETSPPTSPTSPASKAPSIYESIGAPQMVQLQSEADFQQGQYEPKIAESNSTKSRGSILNM
LARNFKTIEKITLYLAFFINVILLFHRVDISHAENAEAASEGDDDEDALESIFITGMQFP
YVEYEITGWMLAQILYWISVLHLSTSFALLVSFYQLKIPLITFKREKEIARKLMFDGCWI
TEEDSEELGIVDTFMWYLDRIVVSAKSFPMMYWDKFVRRKTRSKFKDQVDEETLTSILGE
EKMSTDSSYDYRYSCWLWIGVILTNGQFLYRVGYLLCSACGVFLSPFFYAFHLIDVVLSF
PMLKAILQSVTHNLQQLILTIMMTLVVVYLYTVIAFNFFRKFYVQEGEEGEEPDRKCHNM
LTCFIYHFYAGVRAGGGIGDELESPYGDDLEYPRMFYDISFFFFVIIILLAIMQGLIIDA
FGELRDQQESATEKLESSCFICDIGKETFDRMPRGFEIHTTKEHNFANYLFFLQHLVNKD
ETEYTGQETYVREKYDNRDWDFFPVGECFVKQYEDQLLQS

BLAST