GenomeNet

>tr:A0A2D0Q1S8_ICTPU [A0A2D0Q1S8] SubName: Full=ryanodine receptor 3 isoform X1 {ECO:0000313|RefSeq:XP_017311641.1};
MAEGGEGEDEIQFLRTDDEVVLQCVAAIQKENRKFCLSAEGLGNRLCYLEPTSEAKYVPP
DLCICNFVLEQSLSVRALQEMLANTGPNGEGNPDHERWAGQGGGHRTLLYGHAILLRHSF
SGMYLACLKTSRSLTDKLSFDVGLQEDSSGEACWWTIHPASKQRSEGEKVRIGDDLILVS
VSSERYLHLSISNGNIQVDASFMQTLWNVQPTCSGSNVAVGYLLGGHVLRLFHGHDESLT
IPGADQSTEQQRLVNYETGKSGSRARSLWRLEPLRISWSGSHIRWGQPFRLRHLSTGHYL
GQTEDRGLELVDREISDTASTAFCFRPSKEKVDSGPKRDIDGMGVAEIKYGDSVCFIMHV
ASGLWLSYQAPDAKSSRLGPLKRRAFLYPEGHMDDGLILQLCQHEESRAARIIRNTTQLF
TQFIRGLDELKGEKAPGVSLPVGELLQTLNDLITYFQQPDSELEHEEKQRQLRSLIKRQD
LFKEEGMLTLVSICIDRLNMYNSAAEFEEFAGEEAGEAWKDILNLFYELLAALIRGNRPN
CTQFSRKLDWLVSKLERLESSSGILEALHCILTESPEALNIIQKDHIRSIISLLYKHGRN
HKILDILCSLCVCNGVAVRANQNIICDHLLPRRDLLLQTRLVNDVQSMRPNIFLGVSEGS
AQYKKWYFELMIDQVDHFVTSEATHLRVGWASTKGYAPYPGGGEGWGGNGVGDDLYSYAF
DGLHLWSGRIPRAVASINQHLLTSDDVVSCCLDLGAPSMSFRINGQPVQGMFEDFNTDGF
FFPVVSFSAGVKVRFLLGGRHGDFKFLPPAGYAPCYEALLPKEKMRVEPVKEYKRDVEGV
RNLLGTTQFLSQASFIPIPVNTSQIVLPPHLENVRDKLAENIHELWGMNKIELGWTYGKV
RDDNKRQHPCLVDFSKLPETEKNYNLQMSTETLKTLLALGCHVVQINVNAEDDLKKIKLP
KDYVMSNGYKPSPLELSDVKLTPGQEVLVDKLAENAHNVWAKDRIKQGWTYGIQQDLKSR
RNPRLVPYSLLDERTKKSNRDSLREAIRTLIGYGYNIEPPDQEAAHVVEKRSVENIRFFR
VEKSYAVKSGKWYYEFEAVTGGEMCVGWARPSCRPDVELGMDDQAYVFDGYRGRRVHMGS
HFFGRTWSKGDVVGCMINMEDKSMIFTLNGEILITNKGSELCFTDFDADDGFIPVCSLGL
SQIGRMNLGKDASTFKYYTMCGLQEGFEPFAVNMNREVTMWFSKRLPTFVNVPADHEHIE
VTRIDGTVDSPPCLNVSHKTFGTQASNNDMIYCRLSMPVEFYSSPRKITNVNEVISDGQK
SKKDNSGKTDYGSITKYFYSVRVFAGQDPASVWVGWVTPDYHYYSKNFNLSKVRTVTVTL
GDERGRVHESVRRSNCYMVCAGDISSSSSGRSNADLIIGCHIDLASGLVSFTANNKELPI
AYQVEPNTKLFPAVFVQPTSPNLFQFEFPKIKDAMPLSSAIFKSLHSNPEPQCPPRLDVQ
TIVAVLWSRMPNTFLSVETARVSERHGWVLQCLEPLQMMAVHIPEENRCIDIMELSEDEA
LRQFHYHTLKLYCALCALGNTRVAHALCSHLDQSQLLYTIDNQYLTGQLREGFYDVLISI
HLETAKEAQLMMKNEFIIPITDETCSIHLFSDDSKRHSLPGVGLSTSLSPRLNFSPACFI
TTKREHLYSPQIPLGILKEKAISMLTEAVQGGGTHIRDPVGGSVEYQFVPILKLIATLLI
MGSLTSEEVRIILLLIEPNVFGESKEEETQLVAAEEPAEKEEASSNEEKAVEAGEEESKE
HKQPPKGLLEKSLPESVKHQMCELLHYFCDCELKQRIEAIVAFSDSFVAKLQYNQKFRYN
ELMQALNMSAAVTAKKTKEFRSPPQEQINMLLDFSAGEDCPCPEDIQEELHAFHEDLRLH
CGIPMEEEEEEPDTSIKGRLLSLLYKIKGRPQKTEEQPSEEKQAAPTNLKELISQTMVSW
AQECKMQNPALVRSMFSLLRRQYDGIGELLRAMRKSYTISEKSVQDAINLLASLGQIRSL
LSVRMGEEEGQLMIDGLGDIMNNKVFYQHPNLMRVLGMHETVMEVMVNVLGGDKSKEIAF
PKMVASCCRFLCYFCRISRENQKAMFEHLSYLLENSSVGLACPAMRGSTPLDVAASSVMD
NNSLALALEEPDLEKVVTYLAGCGLQSCPMLVAKGYPDIGWNPIEGERYLSFLRFAVFVN
GESVEENANVVVKLLIRRPECFGPALRGEGGQGLLAAMLEAIKISEDPALDLPNLPEGGA
PVSGEDGEEEEEVAHMGNSIMSFYSALIDLLGRCAPEMHLINTGKGEALRIRAILRSLVP
TKDLVGIISIPLKVPVLNKDGSVTEPDMNASFCPEHKSPMVLFLDRVYGIEDQSFLLNLL
EVGFLPDFRVSASLDTEVLSTTETALALNRYIGSAVLPLLTRCAHLFAHTEHYATLMDST
LHTIYRLSKGRSLTKAQRDSIEECLLAICKHLRPSMLQQLLRRLVFDVPQLTEYCKMPIK
LLTNHYEQNWKYYCLPSGLGSYGMASEEELHLTKKLFWGLFDALSQKKYDAELFKMAMPC
LSAIGGAIPPDYVDMSPANTLVKQASVDGQGNFDPKPISTANISLPEKLDYIANKYAEHC
HEKWSSEKFALGWTAGEKVDDQAKTHPLLKQYKALSEKERETYRYPVKESLKSMLAMGWT
IERTKEGEAMFQQRESGKQISEASQGDGFHPAPVDLENVILSRELQSMVETVAENYHNIW
AKKKKMELSSKGGGTHPLLVPYDTLTAKEKFRDREKAQELFKFLQINGYAISRGLKDIEQ
DSSSMEKRIAYKFLKRLLSYVDSAQEFIAHLEAMASSGKTDKSPHEQEIKFFAKVLLPLL
DQYFKNHCLYFLSSPSINLSSSGYASNKEKEMITSLFYKLASLVRHRISLFGSDSATMVS
CLHILAHSLDFRTVMKSGSELVKAGVRTFFENAAEDLEKTVENLKLGKLGQSRTQMKGVA
QIINYTSVALLPILTALFQHITEHQFGADLLLDDVQLSCYRILTSLYSLGTGKNIYVEKQ
LPVLGECLATLVGAMPVAFLEPHLNMHNPRSVFNTKTPRERAILSMPDTVEEMCPEMPRL
DGLMKDIHDISESGARYTEMPHVIEVILPLLCNYLSYWWEKGPENSPSHVSCCTTVTSEH
LSLILGNILKILNNNLGIDEASWMKRLAVYTQPIISKAGADLLRTHFLPTLEKLKKKTVK
VVAEEEMIRAESRADTQEAELQILDEFAVLCRDLYAFYPMLIRYVDNNRSKWLKKPNADS
TELFKMVSEIFILWCKSHNFKREEQNFVVQNEINNLAFLTGDSKTKMSKSGGQDQERRGK
KRKRELYSIQTSLIVAAHKKLLPIGLNMCTAGDQELISLAKIRYSLKDTDDEVKDHLRQN
LHLQEKTEDPAVQWQLNLYKDVEVKSEEPLNTDHIIEKIQGISAAVFHLDQVEQPLRCKK
LTWQKQLSKQRKRAVVACFRMAPLYNLPRHRSINLFLMGYQKLWIVAEEYSFEEKLVQDL
AKTPMAAEKEEEEAEAEVQPDPLNQLILHFSHNALTERSVLEVDPLYIAYADMMAKSCAE
DEEEEEEEGKEKTFEEKEMEKQKILYQQARLHARGAAEMVLQMISASKGRLGPMVTFTLK
LGISILNGGNVVVQQKMLDYLKDKRDAGFFKSLSGLMQSCSVLDLNAFERQKKAESLGMV
TEEGSVNVSERGSKVLQNDEFTKDLFRFLQLLCEGHNDDFQNFLRTQTGNTTTVNIIIST
VDYLLRLQESISDFYWYYSGKDIIDEHGQLNFSRALAVAKQIFNSLTEYIQGPCIGNQQS
LAHSRLWDAVVGFLHVFANMQMKLSQDSSQIELLKELMDLQKDMVVMMLSLLEGNVVNGT
IGKQMVDTLVESSSNVEMILKFFDMFLKLKDLTTSDNFKEYDPEGKGIISKKEFQKSMES
QKQYTQSEIEFLLSCAEADENDMFNYMEFVERFHEPAKDISFNVAVLLTNLSEHMPHDSR
LATFLDLAESVLGYFEPYLGRIEIMGGAKRIERVYFEISQSSREQWEKPQVKESKRQFIF
DMVNEGSESEKMELFVNFCEDTIFEMQLASQISEPGAVERPEEEEEPHSLLEDLSEEEDQ
SLESASAFTVACNSLKNKISQFRQTLTLKNMRKQFKKFKKLTIKEMITGFFLFFWMLFTG
FFKGIFSLIFGFFHIIWSSMFGGGLVEGAKNMKVTDILGNMPDPTQFGIHGDVMEPEKAE
NGEIVVSTEMVQMVGTVDKLEADAIIDLISPPTKREGKHGHEPGLGDVSEIMTEASPRVE
KKKRQKAAAEEFEPEKADTENHEKEDKAKEEKPEEPVVEEIPAPRKRRGPTKEEPPALMA
AFFAGLEVYKTKMLNYLARNFYNLRMLALFVAFAINFILLFYKVTGEADDEEEEESWGGG
GDDDDDDDDIEFYVLQESTGYMAPTLTFLAILHTVISLLCVVGYYCLKVPLVVFKREKEI
ARKLEFDGLYITEQPSDDDIKGQWDRLVIATPSFPNNYWDKFVKRKVINKYGDLYGAERI
AELLGLDKSALDFDPTEEAVVKEASLLSWLSSIDTKYHIWKMGVVLTDNSFLYLIWYTTM
SILGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNF
FRKFYNKSEDDDAPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDPYELYRILFDI
TFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGNDYFDTTPHGFETH
TLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQLG

BLAST