GenomeNet

>tr:A0A2D0SNI3_ICTPU [A0A2D0SNI3] SubName: Full=ryanodine receptor 1-like isoform X3 {ECO:0000313|RefSeq:XP_017344264.1};
MAEGGEGDEEIQFVRTEDQVVLQCTATILKEQIKLCLSCEGFGNRLCFLETTSNAQNVPP
DLAICVFILEQSLSVRALQEMLSHTSEDVDLDKWSSQGGGHRTLLYGHAILLRHTHSGMY
LSCLTTSRSLTDKLAFDVGLQEDSTGEACWWTIHPASKQRSEGEKVRVGDDLILVSVSSE
RYLHLSYASGDLMVDASFMQTLWNMNPVSSGCELVEGYLTGGYVLRLFHGHMDECLAIPA
AEQGEERKNAHYEGGPVCSHARSLWRLEPLRIGWSGGHIKWGQPFRVRHITTGRYLCLDD
EKGLLVVDPEKANTKSSAFCFRASKEKTEVAQKRDVEGMGAPEIKYGESMCFVQHVATGL
WLTYASVDAKSARLGPVKRKAILHQEGHMDDALTVARSQTEESQAARMIYSTAGLFTQFI
KSLDTLSGKNKSAAPPPPSLPLESVVLLLQDLIFYFRPPDEDLEHEEKQSKLRSLKNRQN
LFQEEGMITLVLDCIDRLNVYNTSAHFSEFAGEEAAESWKEIVNLLYELLASLIRGNRAN
CALFCDNLDWLVSKLDRLEASSGILEVLYCILIESPEVLNIIQENHIKSIIALLDKHGRN
HKVLDVLCSLCVCNGVAVRSNQNLITENLLPRRDLLLQTQIINYVTSMRPNIFLGTCEGS
TQYKKWYYELIVDHVEPFLTAQAGHLRVGWALTEGYSPYPGGGEGWGGNGVGDDLYSYSF
DGLHLWSGRVPRHVASPSQHILAAEDVVSCCLDLSVPSISFRINGHPVQGMFENFNLDGL
FFPVVSFSAGIKVRFLLGGRHGDFKFVPPPGYAPCYEAVLPKDKLRIEPIKEYKNDLDND
VRNLLGPTQSLSHTAFTPNPVDTVQIVLPPHLERIREKLAENSHELWAVTRIEQGWTYGP
FRDDNKKLHPCLLDFQSLPEPERNYNLAMSGETLKTLLALGCHVGMGDEKAEENLKKIKL
PKTYTQSNGYKPAPLDLNHVKLTPNQNTLVERLAENGHNVWARDRVRQGWTYSIVQDIVN
KRNPRLVPYNLLDEKTKKTNRDTVCAAVRTLIGYGYNIEPPDQESSGHVGNGTGNKIRVF
RAEKSYAVTQGKWYFEFEAVTVGEMRVGWARPNVHADKELGTDDLAYVFNGCKGQRWHVG
SEPFGRQWQPGDVVGCMIDLAELNIMFTLNGEMLISDSGSEMAFKDIEIGEGFIPVCSLG
LSQVGRINLGQNVSSLRYFTICGLQEGFEPFAINMKRDITMWFSKSLPQFIPVPTDHPHI
EVSRVDGTVDSAPCLKLTHRTFGSQNANTDLLFFRLSMPIEFHESFKVEAGATPLTRALT
IPEDEALEVDPNSEYELLKKSATRREQEEKEKEPSVPKELPGTKEAENEKDTTTEKSKKR
GFFSKAKKAAFITPPPVVPTVPRLMEDVVPDDRDDVDIISNTTTHYYSVRVFAGQEPGGV
WAGWVTPDYHYYDLHFDISKVRNVTVTVGDDKGNIHHSMKRSNCYMVWGGEFSGSQQTRI
TQEDFVIGCLVDLDTGLMTFTANGKEVNTFYQVEPNTKLFPAVFCLPSSQNMLQVELGKL
KNIMPISAAMFRSDRRNPVPQCPPRLDVQMLTPVIWSRMPNRFLSHQTGRVSERLGWMVQ
CTDPLTMMALHIPEENRCIDILELSECTDLLKFHHHTLKLYGSVCALGNNRVAHALCSHV
DESQLFYAIENSYLPGPIRSGYYDLLISMHLESAKRNRLMTNREFIVPMTDETRSITLRA
HTLPAVGRSTCLRPTLQFSHTGFVGTNADLYTLSPFIPLQTLKDHALSMLTEAVQDGGQA
MRDPVGGSVEFHFVPILKLISTLLIMGVFEDEDVKHILKLIEPTVFREEKGGQAEEDKSG
EGTERQLASKEAGVEVKEKEERVDGWTEDEGMGEEEEEEEELEDDEEEEEDQTEQEDEEE
HPAPEKADKEKAERREAEPQAEPEAGPIVGREEPKEEEEVGEGLLHMKLPESVKLQMCTL
LQYFCDCELRHRVEAIVAFSDRFVTQVQSNQKQRYNQLMQAFTMTAAETARKTREFRSPP
QEQVNMLMNFKNCPDEEDSPVPEEVRGELQMFHNDLLAHCGIHVEEEEEEEHVDTSLRGR
FFRLLEKVKRLRRRKQETEKEPEEEKKPSTLQELISHTMIHWAQESFIQDPELVRLMFSL
LHRQYDALGELIRALPKAYTINAVSMQDTMELLECLSQIRSLLIVQMGPEEERLMIQSIG
NIMSNRVFYQHPNLMRALGMHETVMEVMVNVLGGGDSKEIRFPRMVTNCCRFLCYFCRIS
RQNQRSMFDHLSYLLQNSGIGLGMRGSTPLDVAAASCIDNNELALALQEQDLEKVVKYLA
GCGLQSCPMLLSKGYPDIGWNPCGGEKYLDFLRFAVFVNGESVEENANVVVRLLIRRPEC
FGPALRGEGGNGLLAAIEEAIKISEDPARDGPTVKKDRRFPMFGGEEQHEENRVHLGNAI
MSFYAALIDLLGRCAPEMHLIQAGKGEALRIRAILRSLVPIEDLVGVISLPQQIPAFGKD
NSIIEPKMSASFVPDHKAPMVLFLDRVYGIDNQDFLLHVLEVGFLPDMRAAASLDTAAFS
TTEMALALNRYLCSAVLPLITKCAPLFAGTAHRAIMIDSMLHTIYRLSRGRSLTKAQRDV
IEECLMSLCKYLRPSMLQHLLRRLVFDVPILNEYAKMPLKLLTNHYERCWKYYCLPNGWA
NFGVSSEEELHLTRKLFWGIFESLAHKKFDAELFKIAMPCICAIAGALPPDYVDASYCSK
TEKKASVDAEGNFDPKPVDTTNTIIPEKLDGFINRYAEYTHDRWAFEKIQSNWTFGEVLD
ENAKTHPMLRPYKTFSEKDKEIYRWPIKESIKAMIAWGWTLDKARDGDEDKGEKKAARKI
SQTAQATYDPSHGYNPQPINISGMTLSRELQSMAEQLAENYHNTWGRKKKMELQAKGCGT
HPLLVPYDTLTAKEKARDREKAHELLRFLQLNGYAVTRGLKDMESDISSIEKRFAYGFLQ
KLLKWMDIAQEFIAHLEAVVSSGRVEKSPHEQEIKFFAKILLPLINQYFKNHCLYFLSTP
AKILGSGGHASNKEKEMIASIFCKMSALVRHRVFLFGTDAPAIVNCLHILARSLDARTVM
KSGPEIVKAGLRSFFESAADDIEKMVENLKLGKVSKGNQPVKGVSQNINYTTVALLPVLT
SLFDHIAQHQFGDDVILDDLQMSCYRIMCSIYSLGTVKTPHAERHRPALGECLAHLAAAM
PVAYLEPHLNEYNAFSVYTTKTPRERAILGLPNEVQELCLDIPELDVLIRDIGHLAESGA
RYTEMPHVIEVTLPMLCNYLPRWWERGVENHPELEGKLCTHVTSEHLNQLLGSIMKIVVN
NLGIDEAPWMKRLAVFSQPIVSRAKPEMLKSHFIPTMEKLKKRTAKVVAEEEHLRMEGKT
EGDEEEGTIRDEFAVLCRDLYALYPLLIRYIDNNRARWLTCPDPDAEELFRMVGEVFIFW
SKSHNFKREEQNFVVMNEINNMSFLTADSKSKMSKAGGSDVERTKKKRRGDRYSVQTSLI
VAALKKMLPIGLNMCSPADHELINLAKFRYSLKDTDEEVREFLQNNLHLQGKVENPSMRW
QMALYKMMAGKAEDADAPEKVVKRVQEVSAVLYHIEVTEHPFKSKKMVWHKLLSKQRRRA
VVACFRMTPLYNLPSHRASNMFLDGYKRNWLHTEGLAFEDRMIDDLSKAMEEEEEEEEEK
ETKPDPLHQLILHFSRTALTEKSKLDIDYLYMAYADIMAKSCHIGEEDEGGDEDQEGDEE
EMSFEVRQSETEKEMEKQRLLYQQSRLHNRGAAEMVLQMISACKGETGCMVSSTLKLGIS
ILNGGNSDVQQKMLDYLKDKKDVGFFLSLQTLMQTCCVLDLNAFERQNKAEGLGMVSEEG
TNMKLERGEKVMADDEFTCDLFRFLQLLCEGHNNDFQNYLRTQTGSTTTINIIICTVDYL
LRLQESISDFYWYYSGKEIIDEPGKRNFSKAMTVAKQVFNTLTEYIQGPCTGNQQSLAHS
RLWDAVVGFLHVFAHMMMKLAQDSSQIGLLKELLDLQKDMVVMLLSLLEGNIVNGTIARQ
MVDMLVESSSNVEMILKFFDMFLKLKDIVASGAFRDYVTDPRGLISKKDFQKAMDSQKQY
TPSEIQFLLACSEADENEMINYEEFASRFQEPAKDIGFNIAVLLMNLSEHVPHDTRLQNF
LEQAESVLNYFRPFLGRIEIMGASRKIERIYFEISEVNRKQWEMPQVRESKRQFIFDVVN
EGGESEKMELFVNFCEDTIFEMNIASQISEKEEEKEEDDEEVDEGNEAGGAGADDEDGDK
NNQSESSSAFAEFLNSVVHFMGMFNFRNLRKQYRRLRKMTIKEISVGIATFLWTILLGVF
HFIFSVCKGFFLIVWHTLFGGSLVEGAKNITVTELLASMPDPTQDEVHGDLPGEAGSGEE
QEAGGVTDSTEAAQGEEEYEDSTEQDVGKIPGIDTPGGLGDMGDTTPVEPPTPEGSPLTK
RKMQPEEGGTEQTGAPEEPPPEPEKADTENREKMEKEAEQKTEGPQEKVMVQKPSKAKKE
MKTIRDGGFELWNELDVQRNKFMNYLSRNFYNLRFLALFIAFALNFILLFYRVSDTPPGD
EELEGSGVFEGSGLFEGSGEQMDGSGAEDMGGDDDDDEDGPVYYFLEESTGYMQPTLSFL
AIMHTVISFICIIGYNCLKIPLVIFKREKELARKLEFDGLYITDQPEDDDIKGQWDRLVL
NTPSYPNNYWDKFVKRKVLDKYGDIYGRERIAELLGMDLASLDVSKQQTDKKPQESDNSM
LAWITSVDIKYQIWKFGVVFTDNTFLYLVWYTVMSLLGHYNNFFFACHLLDIAMGVKTLR
TILSSVTHNGKQLMMTVGLLAVVVYLYTVVAFNFFRKFYNKSEDEDEPDMKCDDMMTCYL
FHMYVGVRAGGGIGDEIEDPAGDEYELYRVVFDITFFFFVIVILLAIIQGLIIDAFGELR
DQQEQVKEDMETKCFICGIASDYFDTTPHGFETHTLEEHNLANYLFFLMYLINKEETEHT
GQESYVWKMYQERCWDFFPAGDCFRKQYEDQLA

BLAST