GenomeNet

>tr:A0A2G2DBI6_9RHIZ [A0A2G2DBI6] SubName: Full=Sugar ABC transporter substrate-binding protein {ECO:0000313|EMBL:PHR22134.1};
MTPAKSKATHLLAAAMAAVLLAGCSGYQPAPKAFHEAVMQPYRLDAGDRLRVTVFEQDGL
TGSYAVDQAGYIAFPLIGAVPARGRTLQELEGNIAASLRQGYLRDPDVSIEIDRYRSFFI
MGEVGQSGQYSYVAGMTVQNAIAIAGGYSPRANQRNVDITRNINGKIMTGRVRITDPILA
GDTIYVRERLF

BLAST