GenomeNet

>tr:A0A2G2INT2_9FLAO [A0A2G2INT2] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:PHR86976.1};
MRVLKSLAQQAGIITPLYTATGWSRGAIIPNETLPVTAAYPYPTWTKSPDLSPFYLYADL
HKTPDYSPVKYTVSDYPAFTAELGGGIMATYTRRPLVPAKSLDALINRCLGSGANGIGYY
MYHGGSTPRGQTNFFSDEAFGSPKISYDFQAPIGEFGNINESFHRLRILHYFINSFSEQL
APMQTVLPKNNESIKPADTVSLRYAVRFKDQSGFLFLNNFQDDTQMTTQKNVQVNLQLEE
GNLQIPERGGFDLAVDENAIFPFHLDIEGLHLNYATAQLMTRFENSGTTYYVFFSPEGTS
AEFSFRFDDSFKMLSNRSIEVDQNSRRWLVKPISTNESMFTFTKGKKKTSILVLSKEKAL
KSWLIPRPTESQLLFTDALVLKTEDSLKFISKGKNAFDLEIFPKTKQVPKLSFGKLNKLQ
SMNLFTGFEVHLPEAQLEFTSSRFSERRLVFDFKGGIPESLNDVFIKLDYEADTAMGFYD
NQLVADQLYLGMPWEIGLRELINLKGAEEMNFYFRPIYKDAPYLVDLKESAYFTGSTGKV
LIKDIKFIPQYQTSMSLLSN

BLAST