GenomeNet

>tr:A0A2G3JCI6_9NEIS [A0A2G3JCI6] RecName: Full=Cell division protein FtsL {ECO:0000256|HAMAP-Rule:MF_00910};
MTRLNLFLLVILIACALALITSQHKARKFYGELQKEEVLSRKLDVEWGQLQLEQSTWAMH
SRIEAEATQKLGMQVPGPNRTQVILPHGERVAKPVTE

BLAST