GenomeNet

>tr:A0A2G5T5E5_9PELO [A0A2G5T5E5] RecName: Full=RING-type domain-containing protein {ECO:0000259|PROSITE:PS50089};
MYTSWNRAIDIVLGINIIVYILFLFSIMIAMGILELHCEHFDQCFLFTTITCFVALIAMI
FHNYYIKRKISRGEVRRIEVHFDNFKSACCFVSYFGVIVNLIVCCFGTNPEIYSTCHIIY
AFTNWLMLVFVSRALKSLVMDIEMHKKHLKNVLIYQIAGIIILPLLTQHIRTWNEKCAIL
ISQLICMPSSWIIADYLTIRDGGLEFREIEVVLDVSDFESDNSNSTDSDSSESQIDCSEV
YQPTGSLCGVCYRTYSISNGKKIPLMLKNCGHTICEGCAGRILKANYNSHLPCPFCRKKT
RVDSVTKLPKNYGMLQMLNDMKRLESFNHSILSDNPKLERRNSFS

BLAST