GenomeNet

>tr:A0A2G8L7H1_STIJA [A0A2G8L7H1] SubName: Full=Ryanodine receptor {ECO:0000313|EMBL:PIK56125.1}; Flags: Fragment;
GDQLCLACAPQSKTSDRSSEQVLLAAQGFGNRLCFLEEASCQNTPPDLSLCVYVLEQSLS
VRALQEMVSTDCMETATQAGNRTLLYGHAILLRHSLSEMYLACLCTSSSRDKLAFDVGLQ
ETVQGEACWWTIHPASKQRSEGEKVRIGDDLILVSVSSERYLHLASAKGNSHPLRVQASF
QQTLWTVWPISSSTVKPHSLSFVNGLDVLRFFHGHLDEFLTVPPIGCKDDENNCIVNYQT
GAVASFARSLWRIEIVSKKWNGGYISWGQPCRIRHITSGKYLAVINGKDICIVPRSHGDL
EEMVFCLQPSKADTVCWDSEQDHGMGSADIKYGDSTAFIQHVSTSLWLSHMVVENLQIRS
GKPTERKAMMHPEGHMDDGFSVARARGEEAKSAGIIRKSTSLFLHFIRYVRV

BLAST