GenomeNet

>tr:A0A2I3TWZ8_PANTR [A0A2I3TWZ8] SubName: Full=ITPR2 isoform 3 {ECO:0000313|EMBL:PNI98692.1}; SubName: Full=Inositol 1,4,5-trisphosphate receptor type 2 {ECO:0000313|Ensembl:ENSPTRP00000093703};
MTEKMSSFLYIGDIVSLYAEGSVNGFISTLGLVDDRCVVHPEAGDLANPPKKFRDCLFKV
CPMNRYSAQKQYWKAKQAKQGNHTEAALLKKLQHAAELEQKQNESENKKLLGEIVKYSNV
IQLLHIKSNKYLTVNKRLPALLEKNAMRVSLDAAGNEGSWFYIHPFWKLRSEGDNDASFW
I

BLAST