GenomeNet

>tr:A0A2K2CAE7_POPTR [A0A2K2CAE7] RecName: Full=RING-type domain-containing protein {ECO:0000259|PROSITE:PS50089};
MRCNACWRELEGRAVSTTCGHLLCTEDASKILNSDAACPICDQVLSESLMKPVEINPNDE
WINMAMAGISPQILMISAYRSVMFYIGQRELEMQYKMNRVVAQCRQKCESMQEKFTEKLE
QLHTAYQKIAKRCQMMEQEIDSLSKDKQELEEKFSEKSRQKRKLDEMYDQLRNEYDSMKR
SAIQPANNFFSRNEPDLFSNHAATMMDNRNPIWKDWTVSTPPTPGPREDIWPARQNSPNS
SPFDISDGSPAKQAAMPVDFGNRRPGAVHAFGAGSGNPSMTLRNLILSPIKRPQLSRSRP
QMFTL

BLAST