GenomeNet

>tr:A0A366DXJ7_9RHIZ [A0A366DXJ7] SubName: Full=Uncharacterized protein DUF4354 {ECO:0000313|EMBL:RBO94803.1};
MFNIKSIFLTLYLVAVSGGAYAAAPDQNVQPMVISSVREHSTTVYGDKIEYNITFDVAIS
NLGKKPLDLSKGCFEAVMPDNSTRSLSMIDEELTEGLLKVGDNRKSFVEFSASDNSIYKA
VAVKYQTTCQ

BLAST