GenomeNet

>tr:A0A368WH57_9BURK [A0A368WH57] RecName: Full=LPD22 domain-containing protein {ECO:0000259|Pfam:PF18834};
MQPDYDSIVGNMLGMDQARGVKTALSEAYGTNPNIEAELQRVSKTTGVPLSTARNMPNEA
KRNAYVNGINAFELAKNYPIFARFITNENNARVAHDDVDNLTALEKAVRELPDEFGSMTG
PTPTFGSYLSGLGQSFTSAAEMARQGTRQQFADALGFEGMSDDAQRRFAAAQMQNQMATP
EFESSTAQGIYGGASSVMQMIPAVTAGILTRNPYITLGVLGAQTQTQSYPRYRLRGAEPE
MALLGATGEGAVEVATEMLPMGFLVNRFGKMGAGDFIKGFLGRELPTEQAATLAQDAIDT
AIANPDKTWGEYVAERPEAAYQTALGSLVASGVFGGMNAVAARAVRQEQNAQNAERSAQF
LERVTQTAQASALAKRDPDKFEQYVELASETGPVQSVYLDANTLMQSGLAEQLAQVSPSV
AEQLTTAAATNGAVQIPISEYAARIAPTEYAQELLDHLKTDPDGFSRNEAREYMQNQAQE
LQAEVEERIAQQDNASEFRESQQRVKDLVLNELNQIGRFTESKNELDATLIAARTAVRAA
QLGTTPEALFERQRLQFAAERIDGQGFDQSGNLQTDTPAFQDWFGDSKVVDDTGAPLVVY
HGTAANVEAFDPSRAGEFGESFGPAVFFTQDPGVAAGYAARWSRSDEFMAARKAEDEALN
RFRQAVLDHGSQSQVVDEAQAEAERLGAERQAITDRIDNMEIPTEGANIVPAYLSMQDPL
IVDAQGQNFRTVTSEAIQRAREEGKDGVIIRNVVDSASAATSRPSDVYVALEPTQIKSAT
GNRGTFDANDPNILHQSQDEPRDLFVAHNLTAANILAANELGGLAAPSIAIGRTASGFDQ
FGEVTLLANPALLNDRSIRTFDADVYSPRQPRAHYNLDLKAFNEFLSTLDPDNLGLSKPD
DQSASGTDGANALLHSDAVRLKFLQEQGKAPKLKNVKTDPLISKAAKLPGNRYELRDSPE
LAKIATAYYEKMSKRIAETSQVVAERRNAMWFEPDGSLKPDTIRAFADDVSRFKESGGKD
IGQYRNDIRKAFQNKNLERRYEQWVTDTFNQMVEGKRIFKGFTQAGNRRYVPYTMDNVVK
EMTRDLRGAEGHFYGAGSVRSAYAQELKTLEQIKARRDQIVSQEAFESIRKEANEVLLDA
LEKLKPFYKYDADSWNYAEDAGAAIAEGPRGLRQAFNVTPEVEQIVGDLVKYLRNLPTEY
FEAKAQRPVQFSEFDTAVVPKGMRKDALQALRDARLKIKTYDPKVEGDRNRVIGQQERLL
FQNQRSPRGAFNPDTNTISLLKNADLSTFLHEAGHYFFESDIALAGELVREGRYFGNAAL
SEGEQQIIDDVSTLLRWHGLTGPIEEQLATWANLGFEEKRAYHERTAESFERYLFEGQAP
SIELQPYFQTFRAWLLNVYRSLKDFLTRNPEAGQLNDDVRAIFDRMLATNEQIELAQQAR
SMMPLFRTEADAENIGMTPDEFAAYQRQDPQAANDAAQDLQARGLRDLQWTRNARNKEIK
KLQRQSADLRREARIEVRREVMNQPVYRAWQFLTGKLTQEDQITPAERPRSDPNVLDPTM
DSLFVAIAKLGGIRKEDVVREWGIEQSERPESGVFGKPVLRVTDGLSLDDMRQALIENGY
LSQEIDNPNWDPRELEEKFDAELRGDRQYSNQVSEAALMDDPVAGEGIDISQLGAGRLEL
ASLREMGLTEDEINVLKARKMTAKVGLHPDLVADLPGIQMGSGDTLVKALLDADPPSVVI
EGLTDARMLQEHGELATPEAIEREADKAIHNEARARMVATEANALAKATGQRRILAAAAK
QFAQAMVARVKVRNLRPSQYANAAARAGKAAEKASRSGDINQAAAEKRTQLVNTYATQAA
YDARTEVDSTIRYLRKFDREGTRKGLDVEYLDQIDSLLARFDLRGGQTLRAIDKRTSLAN
WLAAQEQEGFEPDVPDYLANEANRTHFKNLTIEQLRGLADTVRQIEHLGRLKKQLLTAKD
KRELDAIVSQIKESIETNAGGRVVNNERRNTLQSQAGYVWRGAMAAHRKAASVVREMDGF
EDGGPLWEYFTRSMNAAGDREAAMRSDAATRLHELAKPVMTGEPMGGRGRYFPTVDRHLN
RGERIAIALNWGNESNRQRLTGGHGWTAAQLQPVLQSLTTQEWQFVQGVWDFFESYRPQI
AAKERRVYGKEPDWIDPSPFTLQTADGQTVTIDGGYYPIKYDPAQSGKAGEFAEAEEAKA
MMRAAYTASTTRRSFTKSRAEEVTGRPLVLTFDGIWQGANEVIHDLAWHEWLIDANRLLK
RLDDPIRTHYGAEYVDVLRKAVKDSARGDIPAANMVEKALHHARVGVTVVGMGWNLTTAM
LQPLGLTNSIVRVGAKWIARGASQFYGSPLQMAEKAREVRAMSSMMDNRAMTMNREINDV
RNRLEARSDWRQKMEATYFVLIQKLQASVDYPTWLGAYEKAMADPANLYPDGTINEARAI
SLADQAVLDSQGGGQIKDLAQIQRGGPLPKLFTNFYSYFNVLMNLTTEQTRKRVRKGQYL
ALAGDYMLLMVVPAVLSAMLRDALKGEDDEDEYIKGIASEFVGYPFGMFVGLREIAGGAQ
AMVGVGGPFNYSGPAGVRLFGEIDKLGKQLGQGELDAALFKSANNVAGILFHYPAGQVNR
LVEGVVALVEGRTRNPLAPLAGVPYDR

BLAST