GenomeNet

>tr:A0A3B4T5Q2_SERDU [A0A3B4T5Q2] SubName: Full=Uncharacterized protein {ECO:0000313|Ensembl:ENSSDUP00000001282};
MSWAVEEWKDGLPGKALQKIQEMEVQLDKLKKERSQKQFQLDSLEAALQKQKQKVDSERT
ETSALKRENQCLVESCDSLEKTRQKVVHDLGVKEQQVSYLEGQLNSCRKTIERLEQELKK
YRNELDRSQPAGSCSLSSSSSEIQPYTTPQKSFSTPAPVPAYRQQDNRLEELQEKYSQEV
EERKKLETELKVLQVKLLNQSSVSVSHKDIAARQAGSSIFPWQQQDQAHSRQSQDAMETP
LKRRGASLWDTHEETPIKPNQRMSSSRAAQSPSGSYQQMEQLKTLNQELRGRVSELERNL
SNQEKEIRSQAVKLQELQTQLNQARKDLTERDRDIAKTSHELSQVTDRHQQAEAKCSSVE
QKLKQVTEEMNCQRHNAESCKRTLEQKLKDQERDSQKELAQLQSSHNALDQQLNQTRTKL
TQEVQQSKKDYNVLQADMEKMGFQRRGMEKEVEEQKQKLLRSEQSLQASQTKEQDLRKKM
EELQKEKNSVTVQLDQSSRRLSQLEEEKKSADQSLKRTQGQLDDLKAKSEGQLEELKKLQ
LKLEQQTQASARELDNLRKTLSDAETKNDRSQNELQKQKQETERVTNRFMDLEKESQELK
SNLTASQSECKELKQEHQALLEWKKEKETMINETEAVQKELRDKMNNLESSLSSLNETSD
ELKKQLMSVEADKASLSAHIDSLKGELLNKSTELEEREHQYKELQSQLSEAGQKHTKELE
NVGVQVAQLEAQVKNLELQLQKEITRAEQAERTNTQLLDEHQTACDLVRSKDQLVELGQA
EISQLRESLSQTTAQQEEQNARLAEEKATLLKQCEESVSAKIEETEQIKLRFDESQQELL
LTKNQVSSMQQFLKVQEQLGAELQKEIKTLSDNQEEHKKMYEKKSEELKLLEGELKDQQG
QTEEKEKQLREAEAQILSLEKQKAELENVMQQMKKETEIIQHVETEKINHLLEQISSLEE
TVASNNDAAEKLPVLKNELDVVNQSHTDLKKSLEALEKSHSSTIQIKSNLENTLTEKSNL
VSALEKEVKELTDKMSKELESHASEIENFLNKEKNLKEQLQATKQSVTAAKAELSSRREE
IRTMKTTLSAASHGLEERDNTIKSLKEKLNKAEAEQAKTSDLLKEKMAAMNKIKVQLEML
QMDLEDNETAMNTFDSQVEELKGTIESLEAQLAQNETQMSHMEARLEDSKAQVSVLESRL
EEVQSQNSVLETQYVTAKEELFDRSCEITRLEEDAVKGKQLEESVAALESKLCQITEENI
KLETALRQITEDKDNDLNQFLQEKNIFETTLKQLTDNKEQVENEIIQVKEQLEALEKLSE
ENKQLQTTVEQLTEEKLQTDTKIDQMTAEKLDVESTVRQVTEEKAQLDHTLNLINEEKIQ
LEAKLSELTSEKNDLVSNLNQVVEEKLQLEINYSQLTEEIIELQSSVNQVTEEKLQLQES
TERHENEVASLKGEKECIQRLLQASEQEHQRTEEENRERSHQFEAEQAQLHQKLASLQKE
LTVFRQQYESLLEQVGEQHSAIQQLSESQRTEGPGEEISHMESEETDIGVSPVEAEGQID
VELTHDSSTKTESLPVKEQLSPVVSELGELSHQSDEAFSETELVFKEEVIDREMIQEHVE
EERQACVVEETRSNEEEKLHHQEQPSDQVPEDSSRPRDVLENDPEVCEMSRPMSSLSETK
ELKSPARDLSKGQDDLTHYKEMITKQENELQTLRLEFDCLNSELALRKELTSELEVQVTN
LEKKVHAAEEEAHSAAHKLNITLEEKTDLADQLVRLSEERETLTLQLQTAKCQLADVIEM
LEGLEMAKGGCDEKFLQQESELKRVRSEKANLEQHILGMESELETMQVERARLQDEMETK
KRTCSGMEQQIETLMAETSQLRSELVSCTEERDELNQSLGLWREKVHSLEKTNGDTRNLI
SILEDDIRAGRKEYETLQGNMEKLKTERQQLLEQINVQEQAISQQSGEREELIGHLNQIK
EDHSSVNQSTESMVSKIQALEGEVNRLSQSLESSLLEKGEIASRLNATQDEVQQMRTGIE
KLQVRIESDERKKKKMGELLKAAQRKSDLLQDRIDALEREKEDVEQSLEEAFLQAETAKA
ELEEERRKVEEEKAKLSEKLLELSAMLESLRSEKQHMERELETKHREIEELKAAKEELER
GLEKAEVDRREEEERHKYKVEELEKGLREEAERQIREVDCLQEQLEASRQREISLEQKSA
ETEVEKDRVQSLLVELEKEKQCLQSSLEEWQTEGDRLRSQGDEWEKERNNLRARIEALEG
EIKELKTLIKAKEEEKDVLEKEWEEEANQRQASVKSISSLMAEKERIEGENGRMVEEKEK
LQSTLLSVEQERNELRCTLASVKEEKERLEQEREVVANEEKKLQTRLALIEEEKHDMQQT
LSSLKQENKRIEEEKQKLEVEKQDLQSSLSLIESEKENLCSALSVLEKEKQRAEEEKEKL
SESLQSTVASMEKDLETHKLSVAQFNEQVSDLTSRAARLSKERDSALSKMNLWMKTCKQL
EQEKQMMLNSSGNQKSTEAEKTKEMEELKAALDGRKRELEEKDKELEEMKSELEEVNKLL
EEKSTEADESMDKYCSLMVEVHKLEEANNALTTRLEQITVSQRANEANTHSSSAVNAHLR
RSGRKSSSKHQGEKMHENTENMAPSTPQRSSPGKRGHRDISDKDSAQEALHNLTKKIKAN
AATTPKPSTEQDDEFRPEGLPELVQKGFADIPLGEMSPFIMRRTTVKRCSPRLAAKQTVL
TSAPDGKLLGPTPLESPSADSSNRKSLSPSSEEKPVCQSLSLLKTPEQKDQTHQGDNCHV
Q

BLAST