GenomeNet

>tr:A0A3B5A9Y2_9TELE [A0A3B5A9Y2] SubName: Full=Uncharacterized protein {ECO:0000313|Ensembl:ENSSPAP00000018223};
MSWAVEEWKDGLPGKALQKIQEMEVQLDKLKKERSQKQFQLDSLEAALQKQKQKVDSERS
EISSLKRENQSLVESCDSVEKARQKASHDLGVKEQQVSYLEGQLNSCRKTIERLEQELKK
YKNELDRSQPAGSASLSSSSVDLQPYTTPQKSFATPAPVQAYRQQDNRLEELQEKYNQEV
EERKRLETELKVLQVKLLSQSSVSVSHKDIAARQAGSSIFPWQQQDQAHSRQSQGALETP
LKRRGASLWDAHEETPIKPNQRMSCSIPVQSPSGSSQQMEQLKTLNQELRGRVSELERNL
SNQEKEIRNQASKLQELQTQLNQARKDLSERDRDLAKTKHELSQATDRHQQVEAKCSSVE
QKLKQVTEEMSCQRHNAESCKRALEQKLKDQERDSQKELAQLQSSHQALDQQLNQTRTKL
TQEIQQSKKDNNVLQADMEKMCVQKGQVEKEMEEQKQRLLRSEQSLQASQTKEQDLRKKM
EELQKEKNSVTVQLDQCNRRLTQLEEEKKSSEQSFKRTQGLLDDLKAKSEGQAEELKRLQ
SKLEQQTQASARELENLKKTLSDAETKNDRSQNELQKQKQETERLSNRLTVLEKESQELK
SNLTASQNECTKLKQDHQALLEWKTEKETLINETEAVQKELTDKINDLESRLSSLNEANG
ELQKKLTCAEGEKANLSSHIDSLKGELLNKSMELEEKEHQYKELQSQFSEAGQKHTKDLE
NVGVQVAQLEAQVKGLELQLQKEISRAEFAERTNTELQEEHQAACDLVRSKDQLVELGQA
EISQLRESLTQATAQQEEQNARLAEEKAALLKQCEESVSAKVEETEHIKLQMEEVQQELL
FTKNQISSMEQFLKVQEQLGAELQKQIKTMSDGEEEMKKMYETKSEELKQLEKELKDQRS
QTEETEKQLREAEAQILSAEKQKDELQILAQEIKKESEILQRGQTEKINTLLDQVSSLEE
KMAANKDAAEKLAVLKNDLDVVNQSYADLKMTLEALEKSHSSTEEIKSNLENTLATKTDL
ISALEKEIKDLTEKMSKESESRALEIENHVNKEKSLKEQLDAAKKTISAAKAESSSRREE
IKTMKTTLSAASRGLEERDNTIKSLKQKLNEAEAEQAKTSDLLKEKVVAMNKIKVQLEML
QMDLEDNETAMNSFDSQTEELKGTIESLEAQLAQNKFQMSDMEARLEESKAQVSVLETRL
DEVQSQNSVLETKYVTAKEELFERSCEVSRLEEDAVKRNQLEETVATLESQLSQMTEENA
NLETSLRQIAQDKDNSVNQLLQEKNNLETSLQQLTHDKQQVETENIQIYAEKKQLEASLE
ELSVENKQLQTSVQQLTEEKQQIEAKIDEMTAEKHEAELALSQVIEEKAQLDVTLNLIKE
ERSELENQLSALTSEKSDLVIKLNQVVEEKLQLESIYNQLSEDNIKLQSRVDEVTEEKLQ
LQGSIEKHENEVASLREENESIQGSLLTSEQERQRLKEQLEMRDERTEEDNKERNQQFEA
EQAELHHKLAVLQKELTVFKHQYDSLLEQVDQQHSLIQQLSESQGTQNPAEQISHMETEE
TDSGAEAAGQIDVESETETSISTSTESLPVEEQCVASELSEPFHQFNETSSETELICKVD
TTEQEIIQEVEEERETSAAVVEEIREDEQHLPQQASEDNCSLRDVSENEPEIFDLSSQSS
PLTEMRESKSSESSQVHDDFNHYKEMISKQENELETLRSEFNLLSSDLELRKELNSELQV
QVQNLEKKVQAAEEEARGATCQLKNALEAKKGLADELTQLSEGNETLTLQLQTAKCQLTD
VMEMLEGLEMAKGGWDEKFLQQESELKRVRSEKANLEQHILGMESELETMQGERTRLRDE
METQKKTGSGMEQQIETLMTETTQLRSELVSCSEERDELSQSLGQWREKVHSLEKTNGDT
RNLISILEDDIRAGRKEYEAVQSNMEKLKTERQQLMEQVKVLEQAVSQQCGEREELIGHL
NQIKEDHTSANQNTESMVGKIQALEGEVCRLSQSLESSLLEKGEIASRLNSTQDEVRQMR
TGIEKLQVRIESDERKKKKMGELLKAAQRKSDSLQDRIDALEREKEDVEQSLEDAVLQAE
TAKDELEEERRKVEEEKKELSEKLSELSATLDNLRSEKEHMERELETKNREIEELKAAKE
ELERGLEKAEVDRREEEEKQKYMVEELEKGMREETERQIKRVDDLQAQLEASRQRETLLE
QKLAEKEEEKDRMQSLLVELEKEKQHLLSSLQELQTEAGRLQSQGEEWEKERNNLSTHIA
ALEEEIQELKTLIKAKEEERDVLEKERENEADQRQASVQSISSLMAEKEQIERENKQLME
EKEKLHSTLLSLQQEGDNLRCTLASVEEEKERLDQERSVLADEKEKLQSGLSLIEKEKHE
LQQNLSSSKQEKEIIEEERQKLEAEKQHLQSSLSLIEEEKKQLTSAVSSLEQEKQQAEEE
KEKLKAEQESLQTTVASTEKELETNKLSVSQLNEQVSELTSRAARLSKERDSALSKMSLW
MKSCKQLEQEKQMMLNSSGGKGSEEVQAEVTQLRMEAEERKKDAEDLKKALEKKTTEAEE
RLMESQENNKELKDLKAALDGQKKEMEEKERKLEEIKSELDELNNLLEEKSKEADDSMDK
YCSLMVQVHKLEETNDALNTRLEQITAGQRTDEANSLSSSTDSRRRSGRKSSPNNTENVA
PQRSPQGSSGKRGHRDISDKDSAQEALHNLTKKIKANAMTTPKPKAEQDDEEFRPEGLPE
LVQKGFADIPLGEASPFIMRRTTAKRCSPRLAARQTPLTSAPDGKVLGPISLQSPSTGPP
TDGSSKKRLSPSGGEKPGHRSRSLLRTPEQKEKQLVGQQTQQGDNCQVQ

BLAST