GenomeNet

>tr:A0A3F2YKK3_SHEVT [A0A3F2YKK3] SubName: Full=Uncharacterized protein {ECO:0000313|RefSeq:NP_659616.1};
MDKLYSAIFGVFMSSSDDDFNNFINVVKSVLNNENYNKKTKKSFLRNYLIIGLVTIVFVI
IFIIFYLKVIK

BLAST