GenomeNet

>tr:A0A418X8S4_9PSED [A0A418X8S4] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:RJG08877.1};
MAQDETAARVGRGPESPVRRDLLRGLLTFYCLTLLPRTVVAAAPNDAQGAFRAVSEFLTG
RRSLRGGLEGDIFQALAAIDLKFPGRVSQLLAVINERRLQVGQLQGVLNAGFPELAPLPR
QIASGWFLGVVGSGFEASSVAYEHALNAEIVEDVLEPQGVCLGNPGVWAELPL

BLAST