GenomeNet

>tr:A0YR79_LYNSP [A0YR79] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:EAW36534.1};
MKKLIYWLMGEKGGKAMFAVWNWLWGRQPESPEPQISLEAAEQSLQLMRESVKKLAEAVS
TQTSTYQRAQQKYQAKVKEIEKLEQLAWVAQQNGNEQEARLALSKAIQIEKFLPQLAGQV
KRAEDYVNLSQERLNQERMKLEAYQIDLANFKDMQEINQALEWVEKVNDEFNINSARSQF
EEIKNTVEQRNLEQQALAELTMNAEENLGGDIERLATEDEISRRLETFRKSHQPSD

BLAST