GenomeNet

>sp:A2X2F1_ORYSI [A2X2F1] RecName: Full=Protein kinase domain-containing protein {ECO:0000259|PROSITE:PS50011};
MAMLHTHELLLLAIVFLSCFFSHVSPALLSSSTIDRLALMSFRSLIRSDPTQALASWGNQ
SVPMCQWYRVACGLRGRRRGRVVALDLANLNLLGMISPALGNLTYMRRLYLPRNSFHGEL
PPELGNLRDLKTLHLEYNSIGGEIPPSLSNCGQLVQIALSNNKLHGGIPSELSSLHNLEV
LDLSENRLTGSIPSDIGNLVNLRVLGMHLNNLTGEIPPEIGKLINLGGLNLFSNQLSGSI
PVSLGNLSALTFLALSFNKLTGSIPPLQGLSSLKTLGLGPNNLKGSIPTWLGNLSSLQVI
ELQESNLEGNIPESLGNLKWLTDLFLLHNNLRGPVPNTIGNLHSLETLSVEYNELEGPLP
PSIFNLSSLQTLGIQFNRLNGSFPVDIGNTLPNLQSFLADENQFHGIIPPSLCNASMMQM
IQAQNNILSGTIPQCLGIHQKSLYSVAFAQNQLETRNDYDWGFMSSLTNCSNLRLLDLGD
NKLRGELPNTVGNLSTRLEYFITGHNSITGKIPEGIGNLVGLKFIEMNNNLHEGTIPAAL
GKLKNLNKLYLTNNKLSGSIPSSIGNLRLLIVLALGGNALSGEIPPSLSNCPLEQLELSY
NNLTGLIPKELFSISTLSASVNLEHNFLTGPLPSEVGNLTNLALLDLSKNRISGEIPSSI
GECQSLQYLNTSGNLLQGKIPPSLDQLKGLLVLDLSHNNLSGSIPKFLGTMTGLASLNLS
FNNFEGDVPKDGIFSNATPALIEGNIGLCNGIPQLKLPPCSHQTTKRKKKTWKVAMTISI
CSTVLFMAVVATSFVLHKRAKKTNANRQTSLIKEQHMRVSYTELAEATNGFASENLIGAG
SFGSVYKGSMRINDQQVAVAVKVFNLKQRGSSKSFAAECETLRCVRHRNLVKGRDFKAIV
YKFLPNRNLDQWLHQNIMENGEHKALDLITRLEIAIDVASSLEYLHQYKPSPIIHCDLKP
SNVLLDDEMVAHVGDFGLARFLHQDPEQSSGWASMRGTIGYAAPEYGLGNEVSIYGDVYS
YGILLLEMFSGKRPTDSKFGESLGLHKYVNMALPDRVASVIDLSLLEETEDGEARTSISN
QTREMRIACITSILHVGVSCSVETPTDRVPIGDALKELQRIREVPQGVARSRSDNPSRHS
NLLMRSNQPCQ

BLAST