GenomeNet

>tr:A3LUS8_PICST [A3LUS8] RecName: Full=V-type proton ATPase subunit a {ECO:0000256|RuleBase:RU361189};
MQPIQLSDDSSSVAPEAIFRSAPMTLVQFYVTIELARDMVYTLGNLGDVHFRDLNSKLTP
FQRTFVSELRNIDTMESQLAFLNSIMIKYETIKSDVFVNLKADMDPLPTTSEMDDMKQKI
TTFYDRIKHLDNSYNVLNEQKMAVVENRHVLNAVTDFHSSSLIGGYNESRISLSLSDGAD
DDNVALLNNRNNSMELGSETINLEESGFDAISGTIVREKVPLLRNILWRTMRGNLYFHDV
PIDNEKLFDYNATQEELVNKNVFIVYIHGDLLRTRVRRIIQSLDGNIFDNVNGGASARAA
TSSELNAKITDLNNIVMTTKNHLIAELLIFQEAYPDYCFIVQRDKLIYQTLNKFDEDSTR
RCLVGEGWIPTSDFGLIRQTLRHLVREKTRRGDGESDSQESVPLTQQGSSPNPVSQTYTN
LGSGNSSLFAIDDATDDFSELEDEEYGSLIAIVNELSTNRTPPTYHNVNKFTSAFQSIID
AYGIATYQEVNPGLATIVTFPFMFAIMFGDIGHGLIVLLISLYLIKNEVHFGAMRNKDEI
FEMAFNGRYIILLMGLFSMYTGFLYNDIFSKTITLFKSGWVWNFPKDYDFTKDGPVTLVA
EKAARTYPIGLDWAWHGAENNLLFTNSYKMKLSVLMGFVHMNYSLFFSLVNYRYFKSRVD
IIGNFIPGFLFMQSIFGYLSLTIVYKWSVDWLGKGKQPPGLLNMLINMFLAPGKVEEQLY
PGQKYIQVFLVLVALVCVPWILVYKPLTLKRQNDRAIQLGYKDLHSQANHSIQLHEEMEA
TQLEEDLNHDPDDDDFEISDDDFHFPNDIEPLHHNSTSHGEDGSDFNFGDIVIHQVIHTI
EFCLNCVSHTASYLRLWALSLAHAQLSTVLWTMTIQNAFYTTGNAGIAMVVALFGLWFIL
TVCILVLMEGTSAMLHSLRLHWVEAMSKFFEGEGYAYEPFTFKSIDL

BLAST