GenomeNet

>tr:A4I7Q8_LEIIN [A4I7Q8] RecName: Full=V-type proton ATPase subunit a {ECO:0000256|RuleBase:RU361189};
MPWRQEHCSGLWRSEDMIRVNIILQREVLHDTMYEVGMLGRVQFLDMNEGVTAFARPFTE
ELRRCEELQRKLHFIEESMCKDADLLERYPGDVNMSATVEEMRSSLLRGQMHMIDDRIES
TVNELTAMLTSLEGFQHEMNQNQEMSLLYYKYRLLVDTPSDMAASNSTSPHHGAAVSSDA
FSRLASLFGFIESKLSEELYRLCYRITRGNAIVEISNEPAMFVDVQTGERNVAKTSFVVL
CASPTMIVRLKKLMIGLGADVYTLDEVQSRGIELTTSTTAHHVEDTIEGVERRKRDVLTQ
WYEEHRLYKTYLKVEKVVLTAMNMCAMSGSTCTASAWVPLRHEQSLRRALQDAVASANGS
VESIVTLHAEQKHPPTFFETNRFTESFQGIVDSYGMARYKEVNPGVFTIITFPYLFGIMY
GDIGHGFLLLFIALFFIGKEKAWRTAQLNEIVAMVFGGRYLLLLMSLFAIYMGVLYNDFF
GFSLNLFSSGYTWAPISEQKGTTYPTTPNGLPSVKPPHVYAMGLDAAWTETDNKLEFYNS
VKMKHAVIVGVAQMFAGLLLSLSNSIYEKNWYKIAFLFVPEFVFLLCTFGYMSILIMVKW
CRTWENTNKAPSILEIMTNFFLQPGSVPNPLFSGQAGLQVFLLLAAFAMVPFMLLGMPYI
EMRDYKRWQQRRQVGGSRRHHGRALRVSVVAIETSDYTDVFLNEPSASLQHRQANYSGDE
SAHRNLMSDDDETANIFGDDSMHPFGVSTANSEEGATATVIERENEKFEHFDVSELIIHY
VIHTIEYVLSSVSNTASYLRLWALSLAHAQLSEVFFSFTVAKTLDIDNSSGFVIAIGVLL
WLGATLGVLVGMEALSAFLHALRLHWVEFQNKFYAGDGQTFDPLDLTTLNTAN

BLAST