GenomeNet

>tr:A5DQY0_PICGU [A5DQY0] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:EDK41583.2};
MDDGAKIQLTIDINEEDGSAVFDFEGTADETFNCFNAPRAVTYACITYCLRCHITEGDLP
MNEGVLAPIEVRIPEGTVLNPSVTAAVSGGNGITSQKITDTILKAFGTVAASYGCMNCLC
FGQGGLDKKTGEMVAGFGFCETIGGGSGAGNGFNGFSGTQCHMTNTLMTDPEVLESRYPV
LLKQFSIRKNSGGAGKWHGGDGLVRELEFTSPCHASILTQRRVVPPYGMAGGGEGARGEN
KLGRVDGNGKIHWKHVGPTAEIELNVGDIIKILTPGGGGYGRAGEHSEPGSEQNGGNLRV
GSLRAGGSLGLMREAMNSSQ

BLAST