GenomeNet

>tr:A5FWS2_ACICJ [A5FWS2] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:ABQ30054.1};
MSEPRVKAGIWVQMALRLGAADGRPGMLLHRGDEDAGGVLVLLRGRMGVVILSQTRDALG
RPAWLRATGPDPVDDARADAYVEKQLRFDPDLWVVEFEAPDYLPPFEGTIL

BLAST