GenomeNet

>tr:A5WBP1_PSYWF [A5WBP1] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:ABQ93082.1};
MAPKAKRYKVEVTEVLSTIVEVMASTEEEAIKKVKKAYRQEQIVLSDEHYVQTEFELNTD
KDNSNH

BLAST