GenomeNet

>tr:A9SEK1_PHYPA [A9SEK1] RecName: Full=Translation machinery-associated protein 22 {ECO:0000256|RuleBase:RU361273};
MAVKLQPVQVLYCPVCSMPAEYCEFSPDFEKCKPWLIKNVPDLYPQLVKEAAEKTAEQLD
GLTVGGENAGAKGEGSSSEPKKEDEVKRLPGGKVKKKEKPEVVVEKIVRNKRKCVTIIKG
LDMFGIKLSEASKKLGKKFASGASVVKGPTEKEQIDVQGDIMYDIVEFITDTWKNVPESA
IYFIEDGKKVSASG

BLAST