GenomeNet

>sp:RAPA_SHEWM [B1KJA5] RecName: Full=RNA polymerase-associated protein RapA {ECO:0000255|HAMAP-Rule:MF_01821}; EC=3.6.4.- {ECO:0000255|HAMAP-Rule:MF_01821}; AltName: Full=ATP-dependent helicase HepA {ECO:0000255|HAMAP-Rule:MF_01821};
MPFSLGQRWISDTESELGLGTVVAVEGRMVTVMFPATDENRMFSRADAPLTRVIFNPGDK
AESHEGWSLTVSEVEEKDNLIIYHGIHDETGEQVSLRETLLNHNIRFNKPQDRLFAGQID
RLERFGIRYQCQQLRHKLATSDMLGLQGPRVGLIPHQQWIAHEVGRRFAPRVLLADEVGL
GKTIEAGLIIHQQLLTGRAERILVIVPDTLRHQWLVEMLRRFNLKFSVFDEDRCVEAYAD
SDNPFYTEQLVICSLELLRKKRRLDQALAADWDLMVVDEAHHLEWTEDAPSRAYRIVEAL
SEEIPGVLLLTATPDQLGHQSHFARLRLLDPDRFYDYEAFLKEETNYADIASTADALAGN
EPLSQEIIDNLKTQLAEKDITAATDIIQATDADVDQQQAARDALLQDLLDRHGTGRVLYR
NSRASVKGFPTRIFNQYPQKMPAQYVTAARVGAMMNGHLDTAGKVKQALSPEKIYQEFES
SSASWWKFDPRVDWLIDFLKENRREKVLIIASQAETALSLEEALRTREGIQATVFHEGMS
IIERDKAGAYFAQETGGAQALICSEIGSEGRNFQFASQLILFDLPLNPDLLEQRIGRLDR
IGQNNDVSIHVPYLEDTAQESLMQWYHKGLNAFEQTCPSGHILFNEFSESLLNVLISQDK
EVLEQVLSDTQTRYAELKSVMEQGRDKLLEINSHGGERANKLVNALAERDEDTNLIGSVI
RLWDIIGVEQEDSGENAIVLRPSEHMMFPTYPGLPEDGITVTFDREMALSRDDIALITQE
HPLVQTGLDLITSSETGTTSVAVLKNKSLPAGTIFLELIYMADASAPKSSQLYRYLPPTP
VRVLLDKNGNNLADNVNYESFNKQLSAVNRHIASKLVNASQAVLHPLFAKGEEFASSELT
LLTESSRAKMTTQLNGELERLEALKAVNPNIRDEELAHLREQMVELNGYLDGAVLQLDAI
RLVLVSHA

BLAST