GenomeNet

>tr:B2BTG6_9CAUD [B2BTG6] RecName: Full=HALZ domain-containing protein {ECO:0000259|Pfam:PF02183};
MENWASAIIGAIVAGFTFLTAIATLATKRNDSSSRMTNKSFDIISKRLDIAEAKVSSLES
VQSDYMILKDDYDDLKEKYSALKLENTRLSERVKELEIKEGKN

BLAST