GenomeNet

>sp:RBL_PARP8 [B2JX50] RecName: Full=Ribulose bisphosphate carboxylase large chain {ECO:0000255|HAMAP-Rule:MF_01338}; Short=RuBisCO large subunit {ECO:0000255|HAMAP-Rule:MF_01338}; EC=4.1.1.39 {ECO:0000255|HAMAP-Rule:MF_01338};
MNDFSKEAVKPADSATAAAKAEKRSRYAAGVMKYREMGYWQPDYTPKDTDVIALFRITPQ
PGVEPEEAAAAVAGESSTATWTVVWTDRLTACDMYRAKAFRVEPVPNPAEGEPQYFAFIA
YELDLFEEGSVANLTASIIGNVFGFKPLKALRLEDMRIPVAYLKTFQGPPTGIVVERERL
DKYGRPLLGATVKPKLGLSGKNYGRVVYEGLKGGLDFLKDDENINSQPFMHWRDRYLFAM
EAVHRAQAETGEVKGHYLNVTAGTMEDMYERAEFAKELGSCIVMIDLVIGWTAITSMGRW
ARKNDMILHLHRAGHGTYTRQRNHGISFRVIAKWLRMAGVDHAHAGTAVGKLDGDPLSVQ
GYYNVLRESHNSVDLTRGIFFDQHWAGLRKVMPVASGGIHAGQMHQLLDLFGDDAILQFG
GGTIGHPSGIQAGATANRVALETMVKARNEGRDIANEGSDLLEAAARHCTPLKQALDTWG
DVTFNYTPTDSPDFAVTPSVA

BLAST