GenomeNet

>tr:B2TM27_CLOBB [B2TM27] SubName: Full=Conserved domain protein {ECO:0000313|EMBL:ACD24069.1};
MDTIEKFREEMTKTREKNNLSKSDLARKISKSPSFICDIESKRKKPSLETTVDIAHALGL
SLDKIFK

BLAST