GenomeNet

>tr:B2UB28_RALPJ [B2UB28] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:ACD27877.1};
MWRMLRCARKVPAGRCVVTAFRTHLIGWGRLSLENASRFCSRPAVSLPSSSPRPTKPAQR
SKPAHFRRRDFVLGCGALLVLGAVPGFRPPSRDASSLDDFMLVSQTISGAPPDRHVGLSC
FSHLHRTDDRFIEHIQTLAWLVRRNPGLDGVGLVRLIDADSACDLRAALARLVDAWSARL
DADPAWGDIRPLIVRASEASLSGS

BLAST