GenomeNet

>tr:B2VCP2_ERWT9 [B2VCP2] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:CAO98086.1};
MAASVTVAGFCSVAHAAVPDNAAVYATEHSKGSMSIAGKDVYTKTFEVMVANLADKEFDL
STLCLKAVAPDHQEFKLDTVDEKLTTGKVKKGQSVKGIAVFASDNAAVQQTALVKLTDDC
K

BLAST