GenomeNet

>tr:B4EC49_BURCJ [B4EC49] SubName: Full=Putative transport-related membrane protein {ECO:0000313|EMBL:CAR52342.1};
MRARGVCRGPLVRLRATIRSDIDDGGAAFRPRQGEVMAQFSVAHDSAYPAEEGGEGGGPA
LPDGYSERLYNEDLAPLKNQTWGSYNIFAFWMSDVHSVGGYVFAGSLFALGLTSWQVLIA
LIVGIGLVNALCNLIARPSQQIGVPYPVACRATFGVLGANVPAVIRGLIAIAWYGIQTYL
ASSALVIVVLKFFPQWLPYADVHRYGFLGLSAVGWAGFMLLWVLQAFVFWNGMETIKKFI
DFAGPAVYVVMFILAGYMVWRAGWRNIGINLGGVKYHGAEVIPVMITAVSLVVSYFSGPM
LNFGDFSRYCRSFGEVKRGNFWGLPVNFLAFSLVTVITTAATLPVFGELITDPVETVGRI
DHPTAVILGALTFTIATIGINIVANFVSPAFDFSNVAPRLISWRAGGMLAAVASIFITPW
NLFNNPAVIHYTLDVLGAFIGPLYGVLIADFYLVKRGRLVRDDLYTMSESGSYWYTGGVN
RRALAALLPAAVIAVACVMVPGWQGVANFSWFIGAGLGFVFYRLLVSAKA

BLAST