GenomeNet

>tr:B4FN05_MAIZE [B4FN05] SubName: Full=Putative choline kinase 2 {ECO:0000313|EMBL:AQK60521.1};
MAAADPPPREKVVPTLKRSASIDRIPVDARRILHRLAGDLWGGDMDPGALAVSQLRGAMT
NEVFRITWLGGEAEGNGPRKVLVRIYGRGVEVFFDRADEVRTFECMSRHGQGPPPPGPLC
QRPRRGVHQLQCTLRLYHPKCVMCLLGSNPRLVFVMAHSRVARVLALPNPLRRGSARPGN
VRRDLLPPSTPYSPPRSRDLLRSCHQCPPPPSLSSPSRLRSATVTRCEAAINAHVLLRAA
TFPGSRALLRRHTFWFSGTPSP

BLAST