GenomeNet

>sp:UBA5_DROWI [B4NDE5] RecName: Full=Ubiquitin-like modifier-activating enzyme 5; Short=Ubiquitin-activating enzyme 5;
MSAIDELQALIVELKSELEAQKTETRQQQAQAQQARQRIDRMSAEVVDSNPYSRLMALQR
MNIVKDYERIREKTVAVVGVGGVGSVTADMLTRCGIGKLILFDYDKVELANMNRLFFTPD
QAGLSKVEAAARTLTFINPDVKIETHNYNITTVDNFDNFLTTISQSGTEPGTPVDLILSC
VDNFEARMAINAACNEHSLNWFESGVSENAVSGHIQFIRPGDTACFACAPPLVVAENIDE
RTLKREGVCAASLPTTMGITAGFLVQNALKYLLNFGEVSDYLGYNALNDFFPKMTLKPNP
QCDDRHCLLRQKEFQTKPKPVKKEVEIVAEEPLHATNEWGIELVAEDAPATEDADEPKPI
VSDIGEGLRLAYEAPSKSTETTSEATTTTTGDETSLDDLMAQMKSM

BLAST