GenomeNet

>tr:B4WQE4_SYNS7 [B4WQE4] SubName: Full=Polysaccharide biosynthesis/export protein {ECO:0000313|EMBL:EDX87332.1};
MACTLSSVVFAVQLPIRAAEYETQNLPVLEAPPEVPAAVNSLDAATPVTTAAPPNDGIIP
SSGFPTVESYTLGAGDQVRVDIFQLPEYSSEYEVLIDGTLSLPIVGQVAVAGLTLEQAER
TISQAYAQRLRRPIIEIFLVTPRPLRVGIAGEVARPGEYILEREGTQFPSLVNALETAGG
ITQSADLRQVVVQRPDSSGGVQTFVANLWQFLNTGDLQYNLALQDGDTIYIPTRSDFDYA
ESLQLSAASFAAEGSQALNVAVVGEVLRPGPYAVSGSSSSRDNGTSAGSNGARQPTVSQA
IQTAGGIQPEADLREVKIYRRTRNGTQLVIDVNLWALLTDGDITKDVALQEGDTVFVPEA
ETLIASEITEAASASFSPETIRINVVGEVEDPGAVEIPPNTPLSQGLLAAGGFNNRARQE
NVELIRLNPNGTATRTSIDVDFAAGLDEAENPLLRNNDVIVVGRSGIASFSDTLGSVVTP
LGRAFSLFSIPLSILNLFD

BLAST