GenomeNet

>tr:B5Y236_KLEP3 [B5Y236] RecName: Full=Riboflavin biosynthesis protein {ECO:0000256|PIRNR:PIRNR004491}; Includes: RecName: Full=Riboflavin kinase {ECO:0000256|PIRNR:PIRNR004491}; EC=2.7.1.26 {ECO:0000256|PIRNR:PIRNR004491}; AltName: Full=Flavokinase {ECO:0000256|PIRNR:PIRNR004491}; Includes: RecName: Full=FMN adenylyltransferase {ECO:0000256|PIRNR:PIRNR004491}; EC=2.7.7.2 {ECO:0000256|PIRNR:PIRNR004491}; AltName: Full=FAD pyrophosphorylase {ECO:0000256|PIRNR:PIRNR004491}; AltName: Full=FAD synthase {ECO:0000256|PIRNR:PIRNR004491};
MKLIRGIHNLSQAPHGCVLTIGNFDGVHRGHQALLQRLREEGRQRGLPVVVMIFEPQPLE
LFAADKAPARLTRLREKLGYLAESGVDYVLCVRFDRRFAALTAQDFISELLVRRLGVQFL
AVGDDFRFGAGRQGDFLLLQKAGAEYGFDVTSTQTFCEGGVRISSTAVRQALADDDLLLA
ETLLGHPFSISGRVVHGDELGRTIGFPTANLPLRRQVSPVKGVYAVEVTGLGDKPIAGVA
NIGTRPTVAGVRQQLEVHLLDVVMDLYGRHINVVLRKKIRNEQRFASLDELKAQIARDEL
TARELFGLTSQA

BLAST