GenomeNet

>tr:B6HBH1_PENRW [B6HBH1] SubName: Full=Pc18g04070 protein {ECO:0000313|EMBL:CAP94631.1};
MASENEITALAVHSSKEDPATFAPESPGVANKDEGLYAETTTNRRNPVGSRLGSVIRAFE
NQLIEYNLEARGIERVAADERMKRNTWMSYLQVSLLWISINLAPNNITLGMLGPAVYGLS
FRDSALCAVFGAFVGSFVASWMATWGPVSGIRTLAFGRYSMGWWPSKIIVVLNLIQMIGY
GLIDCVVGGQILSAVSPGGMSVAVGIVIVAVISWAVATFGIQVFHYYERFAFLPQVIVVC
ILFGVSSVKFDLSTTSTGDPRTVAGNRLSFFSICLSAAVTYTPLAADFFVYYPENTSRAK
LFGLSLGGLLVSFTMALVSGVGLASGVSKHPEYSAAYEQGQGALIVEGFSPLHGFGKFCS
VICALGLIANTVAPTYSAGIDFQILGRYAEAVPRVIWNTIAVIIYTVCALVGRSNLSEIF
TNFLALMGYWVVIWIAIVLEERFIFRLRTGYNWHIWRDPSKLPIGIAAFTAFVVGWVGAV
LCMAQVWYIGPIAKLVGEYGADMGIYVGFCWTALVYPPLRFIELRFMPCPSIRVSHIAAF
GQGSARRLIRGFAYTTAFPRCIRLH

BLAST