GenomeNet

>sp:BCHL_RHOCS [B6ITW5] RecName: Full=Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein {ECO:0000255|HAMAP-Rule:MF_00355}; Short=DPOR subunit L {ECO:0000255|HAMAP-Rule:MF_00355}; Short=LI-POR subunit L {ECO:0000255|HAMAP-Rule:MF_00355}; EC=1.3.7.7 {ECO:0000255|HAMAP-Rule:MF_00355};
MSSVLERPAAPAILPSRQDGEGSVQVKMDPNLKIGTARVFSVYGKGGIGKSTTSSNLSVA
FSKLGKRVLQIGCDPKHDSTFTLTKKLVPTVIDVLESVNFHSEELRPEDFVYPGYNGVMC
VEAGGPPAGTGCGGYVVGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGFAAPLQHAQRAL
IVAANDFDSIFAMNRIVAAIQAKSKNYEVRLGGVICNRSAATDQIDKFNAAVGLNTLAHL
PDLDGIRRSRLKKCTVFEMEDEPELERARQEYLRLAATLLAGTEPLAPAPLRDRDIFDLL
GFD

BLAST