GenomeNet

>tr:B6WT73_9DELT [B6WT73] SubName: Full=Tat pathway signal sequence domain protein {ECO:0000313|EMBL:EEB33985.1};
MSQTMPPELFPSHGPSIRAALEVADADGVTAQRVASARATALQLGLPDSVVEADLQYAQR
EAQARRIEQNSPFALWAARSKERAALARDDTDGLAGVFSTAKAFGEIRQYEPGFWEALGT
YLKEGGEDTAENIVATVGAIAGKLGANDFADQVERLAKQREKRRPAPLESNSAVQNYAGD
VVRALPQFAGGVLSYIAGGPLGAVMFGAAQTGGSQYRSLRQENVERDRAFMAAAATAGLS
APLDALGTGKFLNIFKASGARQIFQNAGIAVGTDFVTEWLQTYPEEAARIWGLAEKNGTT
LEEGVRLFFDNFWEMTRQGWYEGFVSMPFGLIGGAGKIAADRRASRDAQAFAEQNTVLHD
AVEASQTKQIAPDYMEDALDHASDVLAQSVYIPAQAALDLAGQGRDVLTPLGITLEEARK
AAASGVDLEVKLSRVHARLDSAGMTAVNDILRQTPGAPNLRELSLIDVNDEVQAALSDAR
QRRRRTDAVRQEEQRLVREMVPLVGKEAAEIYGKLNTAQARAFEAAYGVDAAGLMRRRSV
GLAGEDTDGDALRQAALYEQTPMGDAARASLERDVHDFGVAVDNIVAAGKLPSDPVKMLG
QTPLVMQLLGRDTVTGKAAAQGGIYAAPHVFDGTHPNMTPEMWKQIPAAMADPIAVFDSD
SPAGRAKGDLVFMLELTDANGATVVVPVALDVAKGRKQAHVNIVKSAYSKESGGVPSNHW
FMRQLKKNARYVNGQKMEPWLRAAGAASPLGSLKDVAATNTSDNRIYTDADLVNLRQGNA
ALYQPSAEARDLKQRFAAMPLIEADSTQWFGPGKAIDADSRNMRKAVHDWARTAFPQGTT
VANADTGWGVQVTPSGIKASLHHGYDELLARSVPFIPQIIESGIHLDSIEKKPGLMSHIF
ANKIRLDGQDYVVGFVLREDRTGNRFYDHELTKIISPDWLKPGRDTSEEALGHRTNRGIS
PDSLNADRFPDGSVVHAARANRGDVMNILRERLGVNDGTGQILFQPDTAGKDRARIRLDS
RTAAIRIFKGADMSSIPHETAHIFVDDLRRVAADDGSIARDRLRADLEQSGRDATPFATI
LSGEVDAEGARAMLRDVREELASLEDSEAGLRDAAAAAGRGADSASMREDIAAARKQNTE
RRRELLPVERMLSGYVRHLDGLAQARRDMATLRRFAGMAEDGGLTAEQWREVQEYAARGF
EQYLGEGRAPVKELDGVFSRMMRWLKNLYASWRQYVGADLDDDVRRVFDRLLATDEQIRN
DPSLRAALELEQEFLADAGLTAAERRELEDLRDRAEAEVTARMDRAVARERGKRYRAAFA
QAKESLQASPFWTFIREVSRRDKPLTDGEAGTGGINRDSLVEYLGEDMVKDIARKMPRLV
NARGRGDTVDSLAMQYPLTDGDADALANLIYDVIVVQDGSVNKLAARQAEQALAEQDRAI
SPEDGLLAGDAYGQYLEAVEKAMRRLGKDRQAQNEQDAARRMEQESLPERYYRDLARREV
ADMAVAQLDAQRFVSALRRALNERSRAVQRGKPVEAVQAMQRARFAFAMMQEVRKVRELV
DTVQKKARKAARVKPGTYPAAQTEAIRKLVSAFGLPAPQQAWDAQSGDMKLRDLVQQSVD
DTEAIDLMPLFPDWLLDLANPDPAAARRGMALDWKALRPLEVEQVGNLLDFLVHSGREQS
RTGKESLRARVQAIADEAAASMSGMKTNYASRRDSLGDDLDRGFSSIDTIEWQCRKADGF
QNVMGRDGSTEGVMEREVYGPLRAATDRYHARLNSMHKAVMPHLVRLLQSAKAWEKKYGS
KTLNVRDEKGAVVPVPEAIRQAGDPGWTAEMVIGMALNMGNTGNRERLRSSYIDGNGKGG
LTYDMVSLLLGDDAAATLFELDAAAMGQMTAGRARRDGILSAADWQAIQGVWDVLGSQWA
DTQAAHKRLYGFAPQGIEPGAFAVRVGDETVRLPGGYYPIKYDPRLDMKMRAQEGKEDVL
DRSEGIFGIPAARKGFTMGRVTHTGRSLRLGVQALQKHLVDSARFIELGYDVRMADRIIN
NPTFAAEYQRVFGMQDYDRFRPNLKGLVVDEAVPDSSLLKAAEKARKHLVYYALSMNLNT
ALMQLTAVFPAVGDVGLVNVSRGLAQLGTRGMGLVREVFAASPYMERRFRNIDDDLARKA
MKFEPGRGMTLIRDGQVYTWEDVANLGMLPIAAADCAVTTAIWAGAYHKKMKELRGTAGW
KMDRDSEYHSQAVAYADKIIAQSNPDNDALSKSAFARDKGIVRLFNAFSGATTKFAQRTR
YMWQGVKRGRVTKWEFARMELYDMLLPALAMVVMKGLAQGLFTGEDDDNEELAKLALSTT
MGQFAMAFPVVGNPAADMLVAAMGAGGGRRAGLSTALDTPLQLAGKMAGLGGKATRGGDI
DGEKLVMSALDLGSYISKIPVGPVTRRAERGYEQWMKGEGTPLSLIMPRSGN

BLAST