GenomeNet

>tr:B7RS59_9RHOB [B7RS59] SubName: Full=Polysaccharide biosynthesis protein {ECO:0000313|EMBL:EEB82534.1};
MLCLSARVPAHLLVLAALIMGLLLGAQGALAQPYKIKPGDVLRIEVLEDPALNRSVLVTP
DGRISVPIAGTVRASGKAVESVQSNLTDRLASGFANPPNVFVSVERLATPKPYVPRQPQT
PQTISVFVVGEAAKPGMLTVPPRTTVLQAFAMMGGFTKFAAQKRIQLRRTDKQSGLETTR
ALNYPSIEAGAAQGRTLLMDGDVILVPQRRLFE

BLAST